KEGG   Ziziphus jujuba (Chinese jujube): 107414286Help
Entry
107414286         CDS       T04794                                 

Definition
(RefSeq) beta-fructofuranosidase, soluble isoenzyme I-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00052  Galactose metabolism
zju00500  Starch and sucrose metabolism
zju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zju00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    107414286
   00500 Starch and sucrose metabolism
    107414286
Enzymes [BR:zju01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107414286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 107414286
NCBI-ProteinID: XP_015877884
Position
3
AA seq 620 aa AA seqDB search
MDAKKSLRDTQQAHYTLLPEYPSVAGPPVTRRRTLKGCALVIASVVFLMSLVALILSQSQ
ELSQKPVEKDGSVPLVTNTTSFSEPRGVAQGVSAIFFLGQNIAWFFSFLGPLFYKGWYHL
FYQYNPDSAVWGNITWGHAVSTDLIHWLYLPIAMVPDRWYDINGVWTGSATILPDGQIVM
LYTGSTNTTVQVQNLAYPANLSDPLLLDWVKYSGNPVLVPPPGIGYKDFRDPTTAWIGPD
GQWRITIGSKINKTGLSLVYKTTDFIHYHLSYNLLHEVPGTGMWECVDFYPVSTNGSKGL
DTSVNAPGVKHILKASLDDTKVDHYAIGTYYAGNDTWVPDNPKEDVGIGLKVDYGRYYAS
KTFYDQNKERRILWGWINETDTESDDLRKGWASVQTIPRNVLFDNKTGTNIIQWPVEEIE
TLRLNSSEFNEVVVGPGSVVPLDIGTATQLDIFAEFEVEKLESEETENDATGCGRGSIER
TKLGPFGILVIADDSLSERTPIFFRLHNSTGGDVTTFFCADETRSSIAPDVLKRVYGTEV
PVLDGEKLSFRVLVDHSIVESFAQGGRRVITSRVYPTQAIYGAARIFLFNNASGINVKAN
LKIWQLNSAFIHPFPFDQIQ
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggatgccaaaaaatccctccgtgatactcaacaagcacattacactctcttgccggaa
tacccttccgtcgccggacctccggtgacccggaggcgaaccctaaagggttgtgctttg
gtaattgcttcggtcgtttttctcatgtctttggtggcattgattcttagccaaagccaa
gaactttcccagaaaccggttgaaaaagacggttcagtaccgttggttacaaatactacg
tcgttttcagagcctagaggggttgcacaaggtgtctcagcgattttttttttggggcaa
aatattgcatggtttttttcttttttaggtccattgttttacaagggatggtatcacctg
ttctaccagtacaatccggattcagccgtgtggggcaacataacatggggccacgctgta
tcaacggacctgatccactggctctacctcccgatcgccatggttcctgatcggtggtat
gatatcaacggcgtatggaccggctcagccaccatcctccctgatggccaaattgtaatg
ctctatactggatccaccaatacaactgtgcaggttcaaaaccttgcctaccctgccaac
ctatctgatcccctcctccttgattgggtcaaatactccggtaacccggtcctggttccc
ccacccggtattggctataaagacttccgtgatccgaccactgcatggattggacccgat
gggcaatggcggatcacaattggatcaaagatcaataaaacaggcttatcacttgtttac
aaaactactgattttatccactatcatctttcgtacaacttgttgcatgaggttccgggt
acgggcatgtgggaatgtgtggacttctacccggtttctacaaacgggtcaaagggtttg
gatacatccgtaaatgcgccgggagttaagcacattttaaaggctagtttggatgacaca
aaagttgatcactatgcaattggtacctattacgccgggaatgatacatgggtacccgat
aacccgaaggaagatgtgggcattgggttaaaggtggattatggaagatactatgcatcc
aaaacattttatgaccagaacaaggagagaaggattctgtggggttggattaatgaaact
gatactgaatccgatgacctccgaaagggttgggcgtccgtacagacaattccaagaaat
gttttgtttgacaataagaccggaaccaacataattcaatggccagttgaagagatcgag
accttgagactgaacagtagtgagttcaacgaggtggttgttggacccggttcggttgtg
ccacttgatattggcacagccacacagttagacatatttgcggagtttgaagtagaaaaa
ttggaatcagaggaaacagagaacgatgccactggttgtggtcgtggttctatagaaagg
accaagttaggaccatttggcattttggtcatcgcggacgactcactctcagagcgaacc
ccgattttctttcgccttcacaattcaactggtggggatgtcactactttcttctgcgcg
gacgaaacaagatcttctatagctcctgatgttctgaaaagggtttatggaactgaagtt
cctgttctggatggtgaaaaactctcttttagagttttggttgatcattcaatagtggaa
agctttgcacaaggagggaggagagttatcacatcgagggtttatcctacacaagcaatt
tatggtgcagcgaggatttttttgttcaacaatgcctccggaatcaatgttaaagccaac
cttaagatatggcagctcaattcagcctttattcatccttttccattcgaccaaattcaa
tga

DBGET integrated database retrieval system