KEGG   Ziziphus jujuba (Chinese jujube): 107425264Help
Entry
107425264         CDS       T04794                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00052  Galactose metabolism
zju00500  Starch and sucrose metabolism
zju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zju00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    107425264
   00500 Starch and sucrose metabolism
    107425264
Enzymes [BR:zju01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107425264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 107425264
NCBI-ProteinID: XP_015890714
Position
8
AA seq 572 aa AA seqDB search
MTMPSILLFCFISLFLGHGVVELEASDHVYRHLQSYQSAPSKQPYRTSYHFQPPKNWMND
PNGPMIYKGLYHLFYQWNPKGAVWGNIVWAHSTSTDLVNWIPHDPAIFPFEESDINGCWS
GSATILPDGKPAMLYTGINPQNQQVQNLATPKSLSDPFLREWVKSTENPLMMPTKENGIN
ATQFRDPTTGWLGHDGRWRVIVGSKRKHGGLAFLYRSKDFVHWTKAQHPLHSNKDGGMWE
CPDFFPVSIKSQIGVDTSLVGPYVKHVLKVSLDDTKHDYYTIGTYNTDKDIYTPDKGHVQ
DTSALRYDYGKFYASKTFFDGPKQRRILWGWINESSSVADDEKKGWSGVQAIPRTLWLDK
SGKQLVQWPIPEIEKLRVNPVTWPSKALKGGSVVEVSKVTAVQADIEISFKITGFEKAEV
LDPSWKDPQIICSQKGASVKGGLGPFGLLVLASNGLEEYTAVFFRIFKADNKYVVLFCSD
QSRSSLNEDNDKTTYGTFLDVDPVHDKLSLRSLIDHSIVESFGGEGKACITARVYPIMAT
ERGAHLYAFNNGTENVQITKLNAWSMKKAKIN
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgccttcaatcttgctcttctgcttcatctctctctttctagggcatggtgtt
gtggagcttgaagcttccgaccatgtttacagacaccttcaatcataccaatctgctcct
tcaaaacaaccttacagaacctcttatcatttccaacctcccaagaattggatgaatgat
cctaatggaccaatgatttacaagggactttaccatcttttctatcaatggaatccaaaa
ggtgcagtttggggaaacatagtgtgggcccattcaacatcaacggatctagttaactgg
atcccacatgatcctgcaatctttccattcgaggaatctgatatcaacggttgttggtca
ggctcagcaacaatcttacccgatggtaaaccagcaatgctctacaccggaataaaccca
caaaaccagcaggttcaaaacctagccacacccaaaagcctctcagacccatttcttaga
gaatgggttaaatccacagagaacccattaatgatgcccactaaagaaaacggtataaat
gcaacccaattcagagacccaaccactggttggcttggacatgatggaagatggagggtc
attgttggttccaaaagaaaacatggtggattagcttttctctacaggagcaaagacttt
gtccattggacaaaagctcagcatcccctccattctaataaagatggtggaatgtgggaa
tgccctgattttttccctgtttcaatcaaaagccaaattggtgttgatacttctttggtt
ggtccctatgttaagcatgttcttaaggtgagtttggatgacaccaagcatgattactac
accatagggacttataacactgacaaggatatctataccccggataaaggacatgttcag
gatacttcagctttgagatatgattacggtaaattttatgcttcaaaaactttctttgac
ggccccaaacagaggagaatcttgtggggttggatcaatgaatcttcatccgttgcggat
gatgaaaagaaaggatggtctggcgtccaggcaataccaaggaccctttggcttgataaa
tccggaaaacagttggtgcaatggccgataccagaaattgaaaaactacgtgtaaaccca
gtcacctggcctagcaaagcgctcaaggggggttcagtggttgaagtttccaaagttaca
gcagtgcaggcagatatagaaatttcattcaaaattactggttttgagaaagcagaagtg
ctagatcctagttggaaagacccacaaattatctgtagccaaaaaggtgcatcagttaaa
ggcggtttaggaccttttggtttactggttttggcttcaaatggcttggaagaatacaca
gcggtgttctttagaattttcaaagctgacaacaaatatgtggtgctcttctgcagtgac
caaagcaggtcgtctttgaatgaagataatgataagaccacttatgggacttttctcgat
gttgaccctgttcatgacaagttgtcactaagaagcctgattgatcactctatagtggag
agttttggcggagaagggaaggcttgcataacagctagagtttatccaataatggctact
gaacgtggagcccatttatatgctttcaacaatggaactgagaatgttcagattacaaaa
ttgaatgcatggagcatgaagaaagcaaaaatcaattga

DBGET integrated database retrieval system