KEGG   Ziziphus jujuba (Chinese jujube): 107432082Help
Entry
107432082         CDS       T04794                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zju00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    107432082
   00500 Starch and sucrose metabolism
    107432082
Enzymes [BR:zju01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107432082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
12
AA seq 570 aa AA seqDB search
MDVLKRLSVSVFLCFLCIISNNGAEASHKYQPELESLGAVQVKHVHRTGFHFQPPKNWIN
DPNGPMHYKGVYHLFYQYNPKGAVWGNIVWAHSVSKDMINWEALDPAIYPSKPFDINGCW
SGSSTILPGNKPIILYTGIDPNKRQVQNIAIPANLSDPYLRQWIKPDFNPIVVPAIGINS
SQFRDPTTAWFYNGHWNILVGSRRKDRGMAYLYRSKNFKYWVKAQHPLHSSPNTGMWECP
DFYPVSVNSKNGLDTSLNGPSVKHVLKASLDLTRYEFYTIGTYNLTLDKYNPDSGLVDGW
DGLRYDYGNFYASKTFYDPIKKRRILWGWSNESDSQQDDIKKGWAGIQAIPRKLWLDSSG
KQLVQWPIEELDILRGKKVEKSNVKLNKGDNVEVNGITAEQVDVEVIFSFSSLDKAEKFD
PSWVNAQNLCGQKGSDVQGGVGPFGLLTLASENLEEFTPVFFRIFKAPNKHVVLLCSDAR
RSSLDKNLYKASFAGFVDVNLSNKKLSLRSLIDHSVVESFGAEGKTCITSRVYPTLAVEG
NAHLYLFNNGSEVITVENLNAWSMKSPHMN
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggacgttttgaaaagactctcagtttctgtttttctttgttttctttgcataataagc
aacaatggagctgaagcttcacacaagtatcaaccagagcttgagtcccttggtgctgtt
caagtcaagcatgtccacagaactgggtttcacttccaaccaccaaagaattggattaac
gacccaaatggaccaatgcattataagggggtataccatctcttttaccagtacaatcca
aaaggtgcagtgtggggcaacattgtgtgggcccattcagtatcaaaagacatgatcaac
tgggaagcgcttgatcctgcaatatacccttcaaagccgtttgatatcaatggatgttgg
tctgggtcttccaccatcctcccgggtaacaaacccataatcctatacaccggaattgat
cccaacaaacgccaggtccaaaacattgccatacccgcaaacctgtccgacccatatctt
cgccaatggattaaacccgatttcaacccgattgttgtccccgccattggtataaactcc
agccaattccgtgacccgacaactgcttggttttacaatgggcattggaatatcttagtg
gggagtagaaggaaagacagaggtatggcttatttatacagaagtaagaatttcaagtac
tgggtaaaggcccaacatccactacactcttcccccaatacgggtatgtgggaatgcccc
gacttctacccggtttcagtgaacagcaaaaacgggttggacacatctttgaatggtcca
agtgttaagcacgttttgaaagcaagccttgatcttacaaggtatgaattttatacaatt
ggaacatacaatcttaccttagataagtataatccagacagcggcttagtggatggttgg
gacgggctgagatatgattatggaaatttttatgcatcaaagacattctatgatcctatc
aagaagagaaggatcttatggggttggtctaatgagtctgattcacagcaggatgatatt
aagaaaggatgggctggaattcaggcaattccaaggaaactgtggcttgattctagtggg
aaacaactggtacaatggcctattgaagaattggatattttaaggggcaagaaagtggag
aaaagtaatgtaaaattgaacaagggagataatgttgaagttaatggaattactgctgag
caggttgatgtggaagttatcttctcattttcgagcttagacaaagcagagaaatttgat
cccagctgggttaatgcgcaaaatctatgtggtcaaaaaggttcagatgttcaaggtggg
gttggaccatttgggctattgacattggcttcagaaaacctagaggaattcacacctgtc
ttctttaggatcttcaaggctccaaacaagcatgtagttctcttgtgctccgatgcaaga
aggtcctctttggacaaaaatctgtataaagcatcatttgcaggatttgtagatgtcaat
ctatctaacaaaaagctttctcttcgtagtttgattgatcattctgttgtggaaagtttt
ggagcagaaggaaaaacatgcatcacatccagagtttatccaactctagctgttgaaggt
aatgctcacctttatttgttcaacaatgggagtgaggttattactgtggagaatcttaac
gcatggagtatgaaaagtcctcacatgaattga

DBGET integrated database retrieval system