KEGG   Zea mays (maize): 100037817Help
Entry
100037817         CDS       T01088                                 

Definition
pollen profilin variant 2
Orthology
K05759  
profilin
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 131 aa AA seqDB search
MSWQAYVDEHLMCEIEGHHLTSAAIVGHDGAVWAQSTAFPQFKTEEMTNIMKDFDEPGFL
APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQAMVVGIYDEPMTPGQCNMVVE
RLGDYLLEQGL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaggcgtacgtcgatgagcacctcatgtgcgagatcgagggccaccacctg
acctccgctgccatagtcggccacgacggcgccgtttgggcccagagcaccgcattccca
cagttcaagacagaggagatgaccaacatcatgaaggacttcgacgagcccgggttcctg
gccccgaccggcctcttcctcggccccaccaagtacatggtcatccaaggcgagcccggc
gctgtcatccgcgggaagaagggatctggaggcataactgtgaagaagacagggcaagcg
atggtggtcggcatctacgacgagcccatgacccctggacagtgcaacatggtggttgag
aggctcggtgactaccttctcgaacagggcctgtaa

DBGET integrated database retrieval system