KEGG   Zea mays (maize): 100126901Help
Entry
100126901         CDS       T01088                                 

Gene name
fcr2
Definition
(RefSeq) ferric-chelate reductase (NADH)2
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
zma  Zea mays (maize)
Pathway
zma00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100126901 (fcr2)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     100126901 (fcr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 100126901
NCBI-ProteinID: NP_001106072
UniProt: Q8W2K4
Position
6
AA seq 279 aa AA seqDB search
MEFLQGQRLETTLAVAAAVVAVAAGSAYLFLRSRKPRGCLDPENFKEFKLVEKRQLSHNV
AKFKFALPTPTSVLGLPIGQHISCRGQDASGEEVIKPYTPTTLDSDVGSFELVIKMYPQG
RMSHHFREMKVGDYMSVKGPKGRFKYLPGQVRALGMVAGGSGITPMFQVTRAILENPKDN
TKVHLIYANVTYEDILLKEELDGMAKNYPDRFKIYYVLNQPPEVWDGGVGFVSKEMIQTH
CPAPAADIQVLRCGPPPMNKAMAAHLDDLGYTKEMQFQF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggagttcctgcagggccagaggctggagaccacgctggccgtcgcggccgccgtcgtt
gccgtcgcagccggctccgcctacctcttcctccgcagtaggaagcccaggggatgccta
gaccccgagaacttcaaggagttcaaacttgttgagaagaggcagctgagtcataatgtt
gccaagttcaagtttgcgctcccaacacctacttctgtattgggtcttccaatcggacag
catataagctgcagaggacaggatgcttctggcgaggaagtgatcaagccttatactcca
actactctggactctgatgttggatcttttgagcttgttataaagatgtatccccaagga
agaatgtctcatcatttccgtgagatgaaagttggtgattatatgtctgtgaagggacct
aagggccgtttcaagtacctacctggacaagtgagagcattaggaatggtagctggagga
tcaggcattactccaatgttccaagtcacaagggcaattcttgagaacccaaaggacaac
acgaaagtacacttaatctatgcaaatgtcacgtatgaggatattcttctgaaggaagaa
cttgacggcatggccaaaaactatcctgatcgtttcaagatctactatgtcttgaatcag
cctcctgaagtctgggacggtggcgtcgggttcgtgtcgaaggaaatgatccagactcat
tgcccagcgcctgccgccgacattcaggtattgcgatgtggacctcctcccatgaacaaa
gccatggccgcgcacctggacgaccttggctacacgaaggagatgcagttccagttctaa

DBGET integrated database retrieval system