KEGG   Zea mays (maize): 100127010Help
Entry
100127010         CDS       T01088                                 

Gene name
a2
Definition
(RefSeq) leucoanthocyanidin dioxygenase
  KO
K05277  anthocyanidin synthase [EC:1.14.20.4]
Organism
zma  Zea mays (maize)
Pathway
zma00941  Flavonoid biosynthesis
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
Module
zma_M00138  Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100127010 (a2)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.4  anthocyanidin synthase
     100127010 (a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DIOX_N 2OG-FeII_Oxy
Motif
Other DBs
NCBI-GeneID: 100127010
NCBI-ProteinID: NP_001106074
UniProt: P41213 A0A1Q0ZSU2
Position
5
AA seq 395 aa AA seqDB search
MESSPLLQLPAARVEALSLSGLSAIPPEYVRPADERAGLGDAFDLARTHANDHTAPRIPV
VDISPFLDSSSQQQQRDECVEAVRAAAADWGVMHIAGHGIPAELMDRLRAAGTAFFALPV
QDKEAYANDPAAGRLQGYGSRLATNTCGQREWEDYLFHLVHPDGLADHALWPAYPPDYIA
ATRDFGRRTRDLASTLLAILSMGLLGTDRGDALEKALTTTTTRTAADDDLLLQLKINYYP
RCPQPELAVGVEAHTDVSALSFILHNGVPGLQVLHGARWVTARHEPGTIIVHVGDALEIL
SNGRYTSVLHRGLVNREAVRISWVVFCEPPPDSVLLHPLPELVTEGHPARFTPRTFKQHL
DRKLFKKKQQHKAKAEEEDGGNGDHHRHEPPPQTN
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgtcgccgctgctgcagctgccggcggcacgcgtggaggctctgagcctcagc
ggcctctccgccatcccgcccgagtacgtccgccccgccgacgagcgagccggcctcggg
gatgccttcgacctggcgcgcacccatgccaacgaccacaccgcgccgaggatccccgtc
gtcgacatctccccgttcctcgacagcagcagccagcagcagcagcgggacgaatgcgtg
gaggccgtgcgtgccgccgccgccgactggggcgtcatgcacatcgccggccacggcatc
cccgccgagctcatggaccgcctgcgcgccgcaggaaccgccttcttcgccctccccgtc
caggacaaggaggcctacgccaacgaccccgccgccggccgcctgcagggctacggcagc
cgcctcgccaccaacacctgcgggcagcgcgagtgggaggactacctcttccaccttgtg
caccccgacgggctcgccgaccacgcgctctggcctgcgtacccgcccgactacatcgcc
gccacccgcgacttcggccgccgaacgcgggacctggcctccacgctgctcgccatcctc
tccatgggcctccttggcacagaccgtggcgacgcgctagagaaggcgctcaccaccacc
accaccaggacagcagctgacgacgacctcctcctgcagctcaagatcaactactacccg
aggtgcccgcagccggagctggccgtcggcgtggaggcccacacggacgtcagcgccctc
tccttcatcctccacaacggcgtgccgggcctgcaggtgctccacggcgcccgctgggtg
acggcgcgccacgagccgggcaccatcatcgtccacgtgggggacgccctggagatcctc
agcaacggccgctacaccagcgtcctccaccgcggcctcgtcaaccgggaggccgtgcgc
atctcctgggtcgtcttctgcgagccgccaccagactccgtgctgctgcacccgctgccg
gagcttgtcacggaaggccaccccgcaaggttcacgccgcgcacattcaagcagcacctg
gatcgcaagcttttcaagaagaaacagcagcacaaagcaaaagcagaggaagaggatggc
ggcaatggtgaccaccaccgccacgagccgccgccgcagaccaactga

DBGET integrated database retrieval system