KEGG   Zea mays (maize): 100127010Help
Entry
100127010         CDS       T01088                                 

Gene name
a2
Definition
anthocyaninless2 (EC:1.14.11.19)
Orthology
K05277  
leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
zma  Zea mays (maize)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100127010 (a2)
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.19  leucocyanidin oxygenase
     100127010 (a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 395 aa AA seqDB search
MESSPLLQLPAARVEALSLSGLSAIPPEYVRPADERAGLGDAFDLARTHANDHTAPRIPV
VDISPFLDSSSQQQQRDECVEAVRAAAADWGVMHIAGHGIPAELMDRLRAAGTAFFALPV
QDKEAYANDPAAGRLQGYGSRLATNTCGQREWEDYLFHLVHPDGLADHALWPAYPPDYIA
ATRDFGRRTRDLASTLLAILSMGLLGTDRGDALEKALTTTTTRTAADDDLLLQLKINYYP
RCPQPELAVGVEAHTDVSALSFILHNGVPGLQVLHGARWVTARHEPGTIIVHVGDALEIL
SNGRYTSVLHRGLVNREAVRISWVVFCEPPPDSVLLHPLPELVTEGHPARFTPRTFKQHL
DRKLFKKKQQHKAKAEEEDGGNGDHHRHEPPPQTN
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgtcgccgctgctgcagctgccggcggcacgcgtggaggctctgagcctcagc
ggcctctccgccatcccgcccgagtacgtccgccccgccgacgagcgagccggcctcggg
gatgccttcgacctggcgcgcacccatgccaacgaccacaccgcgccgaggatccccgtc
gtcgacatctccccgttcctcgacagcagcagccagcagcagcagcgggacgaatgcgtg
gaggccgtgcgtgccgccgccgccgactggggcgtcatgcacatcgccggccacggcatc
cccgccgagctcatggaccgcctgcgcgccgcaggaaccgccttcttcgccctccccgtc
caggacaaggaggcctacgccaacgaccccgccgccggccgcctgcagggctacggcagc
cgcctcgccaccaacacctgcgggcagcgcgagtgggaggactacctcttccaccttgtg
caccccgacgggctcgccgaccacgcgctctggcctgcgtacccgcccgactacatcgcc
gccacccgcgacttcggccgccgaacgcgggacctggcctccacgctgctcgccatcctc
tccatgggcctccttggcacagaccgtggcgacgcgctagagaaggcgctcaccaccacc
accaccaggacagcagctgacgacgacctcctcctgcagctcaagatcaactactacccg
aggtgcccgcagccggagctggccgtcggcgtggaggcccacacggacgtcagcgccctc
tccttcatcctccacaacggcgtgccgggcctgcaggtgctccacggcgcccgctgggtg
acggcgcgccacgagccgggcaccatcatcgtccacgtgggggacgccctggagatcctc
agcaacggccgctacaccagcgtcctccaccgcggcctcgtcaaccgggaggccgtgcgc
atctcctgggtcgtcttctgcgagccgccaccagactccgtgctgctgcacccgctgccg
gagcttgtcacggaaggccaccccgcaaggttcacgccgcgcacattcaagcagcacctg
gatcgcaagcttttcaagaagaaacagcagcacaaagcaaaagcagaggaagaggatggc
ggcaatggtgaccaccaccgccacgagccgccgccgcagaccaactga

DBGET integrated database retrieval system