KEGG   Zea mays (maize): 100136827Help
Entry
100136827         CDS       T01088                                 

Definition
phosphoinositide-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
zma  Zea mays (maize)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100136827
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100136827
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100136827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 553 aa AA seqDB search
MGTTYKCCFIFKRRFHTRDAPPPEDVRALFSVHAGGGPHMGADDLRRYLVATGQEEAEVE
RLLEQIVQGRARVPRLARPLLSLDDFHRYLFSHDLNPPIRHPQVHHDMTRPLSHYFIYTG
HNSYLTGNQLSSDCSDTPIIMALERGVRVIELDMWPNSTIDDINIVHGRTLTTPVSLIKC
LRSIKKHAFVASPYPVIITLEDHLPSQLQEKVAKMVVEVFGNILYYPPDDTHELKELPSP
EQLKGRVLLSTKPPKEYLETKLGDSTKEGDADLHLGKGTGDDAVWGKEVPDFRTEIQSAE
KDDENDDVDDEEEQKLQPHIAPQYKHLITIRAGKPKDSLADALKSDPEKVRRLSLSEQQL
AKAAKDHATEIVRFTQRNILRIYPKGTRVTSSNYNPFVGWVHGAQMVAFNMQGYGRALWL
MHGFYKANGGCGYVKKPDFFKQTHFDQYSPPDFYTRVGIAGVPADSVMKKTNAIEDNWTP
VWEKEFSFPLTVPELALLRVEVHEYDMSEKDDFGGQTVLPVSELRPGIRAVALFDRKGMK
YNHVKLLMRFEFA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccacgtacaagtgctgcttcatcttcaagcgccggttccacacccgcgacgcg
ccgccgcccgaggacgtccgcgcccttttctccgtccacgccggcgggggaccccacatg
ggcgccgacgatctacgacgctacctggtggccacgggccaggaggaggccgaggtggag
cggctgctggagcagatcgtccagggccgtgcccgcgtcccgcgcctcgcccgcccgctc
ctctcgctcgacgacttccaccgctacctcttctcgcacgacctcaacccgcccatccgt
cacccgcaggtgcaccacgacatgacgcgcccgctttcccactacttcatctacaccgga
cacaactcctacctcaccggcaaccagctcagcagcgactgcagcgatacccccatcatc
atggcactggagagaggggtcagggtcatcgagctcgacatgtggccaaattcaaccatt
gacgacatcaacatcgtgcacggcaggacactgacaaccccagtttctctcatcaaatgc
ctgagatccatcaagaaacacgcctttgttgcatctccctatcctgtcatcataacgctt
gaagaccacctcccctctcaactccaggagaaagttgccaagatggttgttgaagtattt
ggcaacatactgtactacccgccagacgacacccatgagctcaaagaattaccatcgcct
gaacaactcaaaggacgtgtcctcctctcaacaaagccccccaaggagtacctcgaaacc
aagcttggtgactccacgaaggagggtgatgctgacctccatcttggcaaaggaactggt
gatgacgctgtgtggggaaaagaagtaccggattttcggaccgagatccagtctgctgaa
aaggacgacgagaacgacgacgttgatgatgaggaagaacaaaaactgcagccccatata
gctccacagtataaacaccttattactatcagagcagggaagccaaaagactctctagct
gatgccttgaagagtgatccagaaaaagttcggcgtctcagtttgagcgagcaacaactt
gccaaagcggcaaaggatcatgccacagaaattgtgaggttcacacagagaaacatactg
aggatataccccaagggcactcgagtcacttcatcgaactacaatccgttcgttggttgg
gtgcatggtgctcaaatggtggcattcaatatgcagggatacgggagagcgctgtggcta
atgcacggattttacaaagcgaatggcgggtgcggttatgtgaagaaaccagatttcttc
aagcagacacacttcgatcagtactctcctccagatttctacacacgggttgggattgct
ggagtcccagcagactcggtgatgaagaagaccaacgcgatcgaggacaactggaccccg
gtgtgggagaaggagttcagcttcccgctgacggtcccggagctcgctctgctgcgggtg
gaggtgcacgagtacgacatgtcggagaaggacgacttcggtggccagacagtgctgccg
gtgtcggagctgcggcccgggatccgggcggtagcgctcttcgaccgcaaagggatgaag
tacaaccatgtgaagcttctcatgcgtttcgagtttgcctag

DBGET integrated database retrieval system