KEGG   Zea mays (maize): 100170238Help
Entry
100170238         CDS       T01088                                 

Gene name
TSA
Definition
tryptophan synthase alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
zma  Zea mays (maize)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100170238 (TSA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100170238 (TSA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100170238 (TSA)
Enzymes [BR:zma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     100170238 (TSA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 319 aa AA seqDB search
MAFALKAAAAGSASFSAAGPRRRAAATGRVSFRSAAPVVAVRAAAAAAAAVAEDKRSISG
TFAELRQQGKTALIPFITAGDPDLATTAKALRILDACGSDVIELGVPYSDPLADGPVIQA
SATRALAKGTTFEDVISMVKGVIPDLSCPVALFTYYNPILKRGVPNFMSIVKEAGVHGLV
VPDVPLEETDVLRSEAAKNNLELVLLTTPTTPNERMEKIAQASEGFIYLVSTVGVTGTRA
NVSGKVQSLLQDIKKVTEKPVAVGFGVSTPEHVRQIAGWGADGVIIGSAVMKTLEEAASP
EEGLKKLEQFAKNLKAALP
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgcgctcaaggccgccgccgcggggtcggcgtcgttctccgccgcggggccg
aggcggcgcgccgcggcgactggtagggtctcgttccggagcgccgcgcccgtggtcgcc
gtcagggccgcggcggcggcggccgccgctgtggcggaggacaagcgcagcatctccggc
accttcgccgagctcaggcagcaggggaagactgccttgattcccttcatcactgctgga
gaccctgacttggccaccacagcaaaagcactcaggatccttgatgcgtgtggttcagac
gtgatcgaactgggtgtgccttactccgatccattggctgacggccctgttattcaggcc
tccgcgacacgcgctctggcaaagggcaccacatttgaggatgtcatctccatggtaaag
ggggtgatacctgacctgtcctgccctgtagcgcttttcacatattacaacccgatcctg
aagcgtggtgtccccaacttcatgagtattgttaaagaagctggagtacacggtcttgtg
gtaccagatgttcctttggaagagacagatgtcttgaggagtgaggctgccaaaaacaac
ctagagctggtgctattgacaacaccgactacaccaaatgaaagaatggagaaaattgca
caggcttcagaaggatttatttatcttgtaagcactgttggagttactggtacacgtgca
aatgtaagcggcaaggtgcaatctcttcttcaggatatcaagaaggtgacagaaaaaccc
gtggctgttggctttggtgtgtcgactccagagcatgtccggcagattgcaggatggggc
gcagatggtgtgattatcggtagcgcagtgatgaagacgttggaggaagctgcttctcca
gaagaaggattgaagaagctagaacagttcgccaagaacctgaaggccgcattgccatga

DBGET integrated database retrieval system