KEGG   Zea mays (maize): 100170238Help
Entry
100170238         CDS       T01088                                 

Gene name
TSA
Definition
(RefSeq) tryptophan synthase alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
zma  Zea mays (maize)
Pathway
zma00260  Glycine, serine and threonine metabolism
zma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
zma01230  Biosynthesis of amino acids
Module
zma_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100170238 (TSA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100170238 (TSA)
Enzymes [BR:zma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     100170238 (TSA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG PcrB TMP-TENI IGPS BtpA NanE Ribul_P_3_epim
Motif
Other DBs
NCBI-GeneID: 100170238
NCBI-ProteinID: NP_001123592
UniProt: B2Y0K4
Position
7
AA seq 319 aa AA seqDB search
MAFALKAAAAGSASFSAAGPRRRAAATGRVSFRSAAPVVAVRAAAAAAAAVAEDKRSISG
TFAELRQQGKTALIPFITAGDPDLATTAKALRILDACGSDVIELGVPYSDPLADGPVIQA
SATRALAKGTTFEDVISMVKGVIPDLSCPVALFTYYNPILKRGVPNFMSIVKEAGVHGLV
VPDVPLEETDVLRSEAAKNNLELVLLTTPTTPNERMEKIAQASEGFIYLVSTVGVTGTRA
NVSGKVQSLLQDIKKVTEKPVAVGFGVSTPEHVRQIAGWGADGVIIGSAVMKTLEEAASP
EEGLKKLEQFAKNLKAALP
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgcgctcaaggccgccgccgcggggtcggcgtcgttctccgccgcggggccg
aggcggcgcgccgcggcgactggtagggtctcgttccggagcgccgcgcccgtggtcgcc
gtcagggccgcggcggcggcggccgccgctgtggcggaggacaagcgcagcatctccggc
accttcgccgagctcaggcagcaggggaagactgccttgattcccttcatcactgctgga
gaccctgacttggccaccacagcaaaagcactcaggatccttgatgcgtgtggttcagac
gtgatcgaactgggtgtgccttactccgatccattggctgacggccctgttattcaggcc
tccgcgacacgcgctctggcaaagggcaccacatttgaggatgtcatctccatggtaaag
ggggtgatacctgacctgtcctgccctgtagcgcttttcacatattacaacccgatcctg
aagcgtggtgtccccaacttcatgagtattgttaaagaagctggagtacacggtcttgtg
gtaccagatgttcctttggaagagacagatgtcttgaggagtgaggctgccaaaaacaac
ctagagctggtgctattgacaacaccgactacaccaaatgaaagaatggagaaaattgca
caggcttcagaaggatttatttatcttgtaagcactgttggagttactggtacacgtgca
aatgtaagcggcaaggtgcaatctcttcttcaggatatcaagaaggtgacagaaaaaccc
gtggctgttggctttggtgtgtcgactccagagcatgtccggcagattgcaggatggggc
gcagatggtgtgattatcggtagcgcagtgatgaagacgttggaggaagctgcttctcca
gaagaaggattgaagaagctagaacagttcgccaagaacctgaaggccgcattgccatga

DBGET integrated database retrieval system