KEGG   Zea mays (maize): 100191222Help
Entry
100191222         CDS       T01088                                 

Definition
uncharacterized LOC100191222
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100191222
   01230 Biosynthesis of amino acids
    100191222
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100191222
   00051 Fructose and mannose metabolism
    100191222
   00562 Inositol phosphate metabolism
    100191222
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100191222
Enzymes [BR:zma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100191222
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100191222
  Exosomal proteins of bladder cancer cells
   100191222
  Exosomal proteins of melanoma cells
   100191222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 304 aa AA seqDB search
MAAAPSFLVSSHLSRLADLRRAAAPATPTVPQQLRVGFSRRRAQRVVAMAGSGKFFVGGN
WKCNGTKDSVSKLVSELNAATLETDVDVVVAPPFIYIDQVKNSLTGRIEVSAQNVWIGKG
GAYTGEISAEQLVDIGCQWVILGHSERRHIIGENDEFIGKKAAYALSQNVKVIACIGELL
EEREAGKTFEVCFEQMKAFADSISNWADVVIAYEPVWAIGTGKVATPEQAQEVHAAVRDW
LTTNISPDVASSTRIIYGGSVNAANCAELAKKEDIDGFLVGGASLKAPDFATIINSVTAK
KVAA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggcgccgtcgttcctcgtgtcctcccatctctcccgcctcgccgacctccgc
cgcgcggcggcgccggccactcccaccgtcccacagcagcttcgcgtcggcttctcgcgc
cgccgcgcccagcgcgtcgtcgccatggctggatccggcaagttcttcgtcggaggcaac
tggaagtgcaacggaacaaaggactccgttagcaagcttgtctctgaactgaatgctgct
accctcgaaactgatgtagatgttgtggtggctcctccattcatctatatcgatcaggtc
aagaattcactaacgggtcgcattgaggtttctgctcagaatgtgtggattggaaaagga
ggagcctacaccggagagatcagtgcagaacaactggtggacatcggttgtcaatgggtt
attcttggacactcagagcgtagacatattattggtgaaaatgacgagtttattgggaag
aaggctgcatatgcattgagccaaaatgttaaggttattgcctgcataggagagcttctg
gaagagagggaagcagggaaaacttttgaagtatgttttgagcagatgaaggcttttgca
gatagtatttcaaactgggccgatgttgtgattgcatatgagcctgtttgggctattgga
accggaaaagttgctactcctgagcaagcccaggaagttcatgctgctgtacgcgattgg
ttgacgaccaacatatcacctgatgttgcctctagcacccgaataatctatggaggttct
gtgaatgcagccaactgtgcagagctagcaaagaaagaggatatcgatggttttcttgtt
ggtggtgcctccttgaaggccccggacttcgccaccattatcaactcagtgaccgccaag
aaagttgcagcctga

DBGET integrated database retrieval system