KEGG   Zea mays (maize): 100191225Help
Entry
100191225         CDS       T01088                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
zma  Zea mays (maize)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:zma00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100191225
Enzymes [BR:zma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100191225
Peptidases [BR:zma01002]
 Metallo Peptidases
  Family M67
   100191225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 274 aa AA seqDB search
MGSRRYDIDTRRCGIHSRPTKSMYLDAQQIVSCQTRVGDHDVGSCAVKHHFPSPIVSWIE
DLSSFGNASFNPVSEYVDEQARASVGQSSASSNLHDMQISVRLTAEFMELAKENTSNNLE
TCGILGASFRDGTYFVTMLIIPKQEGTAHSCQAVSEEEIHAVLSEQSLYPAGWIHTHPSQ
TCFLSSIDLHTQYSYQVMLPEAVAIVVAPTDPTRSYGIFRLTEPGGMDVLRECDESGFHT
HRETTNGSPIYETCSKVHFNPNLRFEIVDLRSAQ
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgggtagtaggagatatgacattgatacgaggagatgtgggatccactcaagaccaacc
aaatcaatgtatctggatgctcaacaaatcgtcagctgccaaactagagtgggagaccac
gatgttggttcctgtgctgtgaagcatcacttcccgtctccaatcgtatcttggatagaa
gatctttccagctttggcaatgcttcttttaatcctgtctctgaatatgtggatgagcaa
gccagagcttcagtgggacagtcttcagcatcaagtaatttgcatgacatgcaaatatca
gtgagattgacagccgaattcatggagcttgcaaaggagaatacaagcaataatctagag
acttgtggaattcttggtgcttcatttagggatggaacttattttgtcacgatgttgatt
ataccaaagcaagaaggaactgctcactcatgtcaggctgttagtgaggaggagatacat
gccgtgttatcagagcagtcactttatcctgcagggtggattcatactcatccttcacaa
acatgctttctatcatcgatcgacttgcatactcaatactcttaccaggttatgttacca
gaggctgttgcaattgtggtcgcacccacagatccaaccaggagttacggaatattcagg
ctgactgaacctggagggatggatgttcttagggagtgtgacgaaagtgggttccacact
caccgagagacaaccaacggcagcccaatctatgaaacctgctcgaaagtgcacttcaat
cccaacttgcggtttgagattgtcgacctgcgctcggctcaatga

DBGET integrated database retrieval system