KEGG   Zea mays (maize): 100191319Help
Entry
100191319         CDS       T01088                                 

Gene name
si660005b01(122)
Definition
LOC100191319
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100191319 (si660005b01(122))
Peptidases [BR:zma01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100191319 (si660005b01(122))
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
1
AA seq 327 aa AA seqDB search
MSWAAIENDPGVFTELLQQMQLKGLQVDELYSLDLDALNDLQPIYGLILLYKWRPPEKDE
GPVIKDAIPNLFFANQIINKACATQAIVSVLLNSPGITLSDELKKLKEFAKDLPPELKGL
AIVNCASIRMLNNSFARSEASEEQKPPSGDDDVYHFINYVPVDGVLYELDGLKEGPISLG
KCPGGVGDAGWWLRLAQPVIKEHIDLFSQNEIRFSVMAILKNRKEMFTVEIKELQRKREG
LLQQMGDPNASRHVEQSLAEVAAQIESVTEKIIMEEEKVKKWKAENLRRKHNYVPFLFNF
LKILEEKQQLKPLIEKAKAKQKSHGPS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgggccgcaatcgagaatgatcctggtgtttttacggaactgttgcagcagatg
caactgaagggtcttcaagttgatgaactctactcacttgacctggatgctctcaatgat
cttcagccaatatatgggctaatattgctatacaaatggcgacctccagaaaaggatgag
ggtcctgtcatcaaggatgcaatcccaaaccttttctttgccaaccagataattaacaaa
gcctgcgcaacccaagctatcgtttcggttctcttgaactctcctggcattacccttagt
gatgagcttaaaaagctcaaggaatttgcaaaggatttgccacctgagctcaaaggactg
gctatagtaaactgcgcaagcattcgtatgttaaacaattcgtttgcaaggtcagaggcc
tctgaggagcagaaaccacctagcggggatgatgatgtataccatttcataaactacgtt
ccagtggatggtgtcctgtacgagcttgatgggctaaaggaaggaccaataagtctaggg
aaatgcccaggtggtgttggtgatgcagggtggtggcttaggctagcgcagcctgtgatc
aaagagcacatcgacctgttctctcagaacgagataagattcagcgtgatggcgatcttg
aagaaccggaaggagatgttcacggtggagatcaaagaactccagaggaagagggagggc
ctcttgcagcagatgggcgatcccaacgcaagcaggcatgttgagcagtcactcgcggag
gtggcagctcagatcgagtctgtgacggagaagatcataatggaggaggagaaggtgaag
aagtggaaagcggagaacctgaggaggaagcataactacgtgcccttcctattcaatttc
ctcaagattctcgaggagaagcagcagctgaagcccctgatagagaaggcgaaggcgaag
cagaagtcccacggccccagctag

DBGET integrated database retrieval system