KEGG   Zea mays (maize): 100191319Help
Entry
100191319         CDS       T01088                                 

Gene name
si660005b01(122)
Definition
LOC100191319
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 327 aa AA seqDB search
MSWAAIENDPGVFTELLQQMQLKGLQVDELYSLDLDALNDLQPIYGLILLYKWRPPEKDE
GPVIKDAIPNLFFANQIINKACATQAIVSVLLNSPGITLSDELKKLKEFAKDLPPELKGL
AIVNCASIRMLNNSFARSEASEEQKPPSGDDDVYHFINYVPVDGVLYELDGLKEGPISLG
KCPGGVGDAGWWLRLAQPVIKEHIDLFSQNEIRFSVMAILKNRKEMFTVEIKELQRKREG
LLQQMGDPNASRHVEQSLAEVAAQIESVTEKIIMEEEKVKKWKAENLRRKHNYVPFLFNF
LKILEEKQQLKPLIEKAKAKQKSHGPS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgggccgcaatcgagaatgatcctggtgtttttacggaactgttgcagcagatg
caactgaagggtcttcaagttgatgaactctactcacttgacctggatgctctcaatgat
cttcagccaatatatgggctaatattgctatacaaatggcgacctccagaaaaggatgag
ggtcctgtcatcaaggatgcaatcccaaaccttttctttgccaaccagataattaacaaa
gcctgcgcaacccaagctatcgtttcggttctcttgaactctcctggcattacccttagt
gatgagcttaaaaagctcaaggaatttgcaaaggatttgccacctgagctcaaaggactg
gctatagtaaactgcgcaagcattcgtatgttaaacaattcgtttgcaaggtcagaggcc
tctgaggagcagaaaccacctagcggggatgatgatgtataccatttcataaactacgtt
ccagtggatggtgtcctgtacgagcttgatgggctaaaggaaggaccaataagtctaggg
aaatgcccaggtggtgttggtgatgcagggtggtggcttaggctagcgcagcctgtgatc
aaagagcacatcgacctgttctctcagaacgagataagattcagcgtgatggcgatcttg
aagaaccggaaggagatgttcacggtggagatcaaagaactccagaggaagagggagggc
ctcttgcagcagatgggcgatcccaacgcaagcaggcatgttgagcagtcactcgcggag
gtggcagctcagatcgagtctgtgacggagaagatcataatggaggaggagaaggtgaag
aagtggaaagcggagaacctgaggaggaagcataactacgtgcccttcctattcaatttc
ctcaagattctcgaggagaagcagcagctgaagcccctgatagagaaggcgaaggcgaag
cagaagtcccacggccccagctag

DBGET integrated database retrieval system