KEGG   Zea mays (maize): 100191460Help
Entry
100191460         CDS       T01088                                 

Gene name
IDP1621
Definition
LOC100191460
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
zma  Zea mays (maize)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100191460 (IDP1621)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100191460 (IDP1621)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100191460 (IDP1621)
Enzymes [BR:zma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     100191460 (IDP1621)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
4
AA seq 354 aa AA seqDB search
MYKAQEELIKVAKHYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGSLRVTVQGEV
IEHSFGEEHLCFRTLQRYTAATLEHGMHPPISPKPEWRALMDEMAVVATKEYRSIVFQEP
RFVEYFRSATPETEYGRMNIGSHPSKRKPSGGIESLRAIPWIFAWTQTRFHLPVWLGFGA
AIKHIMQKDIRNIHILKEMYNEWPFFRVTLDLLEMVFAKGDPGIAAVYDKLLVADDLQSF
GEQLRKNYEETKELLLQVAGHKDVLEGDPYLKQRLRLRESYITTLNVCQAYTLKRIRDPS
FQVSPQPPLSKEFTDESQPAELVQLNEQSEYAPGLEDTLILTMKGIAAGMQNTG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagcacaagaagagctcatcaaggtggcaaagcattatggagtgaagctgaca
atgtttcatggaagaggtggaacagttggcagaggtggtggtccaacccatctggctata
ttatctcagccaccagacacgatacatggatcgcttcgtgtaacagttcaaggcgaagtt
attgagcactcctttggagaggagcacttgtgctttagaactttacaacgctacactgca
gctactcttgagcatggcatgcatcctccaatttcccccaagccagaatggcgtgctctg
atggatgaaatggctgttgtagcaactaaagaatatcgatcaattgtctttcaagagcca
cgcttcgttgaatacttcagatcggctacgcctgagactgaatatggcaggatgaatatt
ggcagccatccatcaaagaggaagcctagtgggggaatagaatcgctccgcgcaatccca
tggatctttgcttggacacaaacaaggttccatctgcctgtttggcttggatttggcgcg
gcgatcaagcacatcatgcagaaggacatcaggaacatccatatactgaaagagatgtac
aatgagtggccattcttcagggtcacccttgatctgctcgagatggttttcgccaagggt
gatccaggaatcgcagctgtgtatgacaaattgcttgtggctgatgatttgcaatccttc
ggcgagcaactgaggaagaactatgaggagacaaaggaactactcctccaggttgccggt
cacaaggacgtccttgaaggtgatccttacctgaagcagcgtctgcggctgcgcgaatcc
tacatcaccaccctgaacgtgtgccaggcctacacgctgaagcggatacgtgacccgagc
ttccaggtgagcccgcagccgccactgtccaaggagttcaccgacgagagtcagccggcg
gagctggtgcagctgaacgagcagagcgagtacgccccgggcctggaggacacgctgatc
ctgaccatgaagggcatcgctgccggcatgcagaacaccggctag

DBGET integrated database retrieval system