KEGG   Zea mays (maize): 100191463Help
Entry
100191463         CDS       T01088                                 

Definition
(RefSeq) uncharacterized protein LOC100191463
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
zma  Zea mays (maize)
Pathway
zma00040  Pentose and glucuronate interconversions
zma00052  Galactose metabolism
zma00500  Starch and sucrose metabolism
zma00520  Amino sugar and nucleotide sugar metabolism
zma01100  Metabolic pathways
Module
zma_M00361  Nucleotide sugar biosynthesis, eukaryotes
zma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100191463
   00052 Galactose metabolism
    100191463
   00500 Starch and sucrose metabolism
    100191463
   00520 Amino sugar and nucleotide sugar metabolism
    100191463
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100191463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 100191463
NCBI-ProteinID: NP_001130368
UniProt: B6T4R3
Position
2
AA seq 473 aa AA seqDB search
MAATAVSVDEKLDKLRAEVAKLSQISENEKAGFISLVSRYLSGEAEQIEWSKIQTPTDEV
VVPYDTLTSPPEDLEETKKLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVI
QIESLNKKYGCNVPLLLMNSFNTHDDTQKIVEKYSNSNIEIHTFNQSQYPRIVTEDFLPL
PSKGKSGKDGWYPPGHGDVFPSLNNSGKLDILLAQGKEYVFVANSDNLGAIVDIKILNHL
INNQNEYCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVNEFKSIEKFKIFNTNN
LWVNLKAVKRLVEAEALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDKAIGINVPRSRF
LPVKATSDLLLVQSDLYTLVDGFVIRNPSRANPANPSIELGPEFKKVANFLARFKSIPSI
VELDSLKVSGDVWFGSGITLKGKVTITAKSGVKLEVPDGAVFENKDVNGPEDL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaaccgcggtgtcggtcgacgagaagctcgacaagcttcgcgccgaggtcgcc
aaactcagccagatcagcgagaacgagaaggccgggttcatcagcctcgtgtcacgctac
ctcagtggggaggcggagcagatcgagtggagcaagatccagaccccgaccgatgaggta
gtggtgccgtacgataccctcacgtcgcctcctgaagatctcgaggagacgaagaagctg
ctggacaagctcgttgtgctcaagctcaacggagggctcgggacgaccatgggctgcacc
ggacccaagtctgtcattgaagtccgcaatgggttcacattccttgaccttattgtgatt
caaatcgagtccctgaacaagaagtatggatgtaatgtccctttacttctgatgaactct
ttcaatacccatgatgacacacagaagatcgttgagaagtattccaactccaacattgaa
attcatactttcaatcagagccagtatcctcgcattgttaccgaggacttcttgccactt
ccaagcaaagggaaatctgggaaggatggctggtatcctccaggccatggtgatgtgttc
ccctctttgaataacagtggaaaactcgacatcttattggctcagggcaaggagtatgtc
ttcgttgctaactcagacaacttgggtgctatagtcgacatcaagatcctgaaccatctg
atcaataaccagaatgaatactgcatggaggttactccaaaaacattggctgatgttaaa
ggcggtactctcatctcttacgaaggaagagttcagcttttggagattgcccaagtacct
gatgagcatgtgaatgagtttaaatcaatcgagaagtttaagatattcaacactaacaac
ttgtgggtgaaccttaaagctgtcaagagactagtagaggctgaggcacttaagatggaa
attattccaaaccccaaggaagttgatggtgtgaaagtccttcaacttgaaactgcagct
ggtgcagctattcgtttctttgacaaagcgattggaattaatgttccccgctcaagattt
ctcccggtgaaggctacatctgatttattgcttgtgcagtctgatctttacaccttggtt
gatggctttgtcatccgcaatccatccagagcgaatccagctaacccttcgattgagctt
ggacctgagttcaagaaggttgccaatttccttgctcggttcaagtccatccccagcatc
gtcgagcttgacagcttgaaggtttctggtgatgtctggtttggttctggaattacgctc
aagggcaaggtgacaatcaccgccaagtctggagtgaagttggaggttccagatggagct
gtatttgaaaacaaggatgtcaatggccctgaggatctttaa

DBGET integrated database retrieval system