KEGG   Zea mays (maize): 100191466Help
Entry
100191466         CDS       T01088                                 

Definition
uncharacterized LOC100191466
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
zma  Zea mays (maize)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100191466
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100191466
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100191466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 472 aa AA seqDB search
MLADDLRRYLAAWGGADGEVPEQIIDRILQDRSRTPRFGRPALTVDDFLHFLFSEDLNPP
LRYSKVHQDMNAPLSHYFIYTGHNSYLTGNQLSSDCSDVPIIKALQLGVRVIELDIWPNS
CKDDIDVLHGRTLTAPVSLIKCLRSIKEYAFVASPYPVIITLEDHLTPDLQERVAKMVLE
VFGDILYYPESKHLQEFPSPEALKGRVMLSTKPPKEYLEAKGDTMKEKEIEARIKRGERE
AAAWGVEVPDIQDEMQVADKDEDELLYRERGADGDDGKETKHVAAEYKHLITIKAGKPKG
PLVDAIKNDPDKVRRLSLSEQELAKVAAHHGPNIVSFTHRNMLRIYPKGTRFNSSNYNPF
LGWVHGAQMVAFNMQGYGRALWLMHGFYKANGGCGYVKKPDFLMQTCPDGKVFDSKADLP
VKATLKVKVYMGEGWQKDFKQTHFDSYSPPDFYVKVCSLVEPVPTFRSQRCL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccgacgacctccgccgctacctcgccgcctggggaggtgctgacggcgaggtc
ccggagcagatcatcgaccgtatcctgcaggatcgcagccgcaccccgcggttcgggagg
ccggcgctcaccgttgacgacttcttacacttcctcttctccgaggacctcaacccgccc
ctccgctactccaaggtccatcaggacatgaacgcgccgctatcgcactattttatatac
actggacacaactcgtatctgaccggtaatcaactcagcagtgactgcagtgatgttccc
atcatcaaggcacttcaattaggtgttcgtgtaattgaattggacatatggccaaattct
tgtaaagatgacattgatgttctccatggaaggacactcactgccccagtatcacttatc
aaatgcttgagatccatcaaagaatatgcttttgttgcatctccctatcctgttattata
actctagaagaccaccttacacctgatcttcaggagagagtagctaagatggtccttgaa
gtgtttggagacatcctgtattaccctgaatcgaaacatcttcaagaatttccttcacct
gaagctctaaaggggcgtgtcatgctgtcaacaaaacccccaaaggagtatctcgaagca
aagggtgacaccatgaaggagaaagaaattgaggcccggattaaaaggggagaaagggaa
gcagcagcatggggagtagaagttccagatattcaggatgagatgcaagtcgccgacaag
gatgaagatgagctattataccgcgaaagaggtgcagatggcgatgatgggaaggaaaca
aagcatgttgcagcagagtacaaacacctcatcactatcaaggcaggaaagccaaagggt
cctctcgtggatgccataaagaacgatccagacaaagttaggcgactcagtttgagcgag
caagagcttgcaaaagttgcagcacatcatggtcccaacattgtgagtttcacgcataga
aatatgctgagaatatacccaaagggaacccgcttcaattcatccaactataatccattt
cttggctgggtgcatggtgctcaaatggtggcattcaatatgcagggatatggaagagca
ctttggttaatgcatggtttttataaagccaatggcggttgcggttacgtgaaaaaacca
gatttcttgatgcaaacttgtccagatggaaaggtgtttgattcgaaggcagatttgccg
gtgaaggcaacattgaaggtcaaggtgtacatgggggaaggttggcaaaaggacttcaag
cagacacatttcgactcatactcacctccagatttttatgtaaaggtctgttcactcgtt
gagcccgtgccaacgtttagaagtcagcgatgcctatag

DBGET integrated database retrieval system