KEGG   Zea mays (maize): 100191564Help
Entry
100191564         CDS       T01088                                 

Gene name
GRMZM2G146463
Definition
(RefSeq) uncharacterized LOC100191564
  KO
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
zma  Zea mays (maize)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo and isoglobo series
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100191564 (GRMZM2G146463)
  Lipid metabolism
   00561 Glycerolipid metabolism
    100191564 (GRMZM2G146463)
   00600 Sphingolipid metabolism
    100191564 (GRMZM2G146463)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100191564 (GRMZM2G146463)
Enzymes [BR:zma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100191564 (GRMZM2G146463)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 419 aa AA seqDB search
MAPEIQSLCPSTTAALLLLAACLAAAVAALDAADYARPPLPAGGGGRRVLFANGLGLTPQ
MGWNSWNHFQCDINEAVVRSTADALVAIGLAKAGYTYVNLDDCWADSERTKEVGYMVANP
KTFPSGIKALADYVHSKGLKLGIYSSAGTRTCSNRMPGSLGYEERDAKMFASWGVDYLKY
DNCYRDGTPETVRFGRMSRALVNSGRPIFYSLCEWGFMEVPKWGGMYGNSWRTTGDINDT
WSGMLDNIDLNDAYARYAKPGGWNDPDMLEVGNGGMAYNEYVVHFSLWAIAKAPLVIGCD
VTRVSNETLGILSNAEVIAISQDRLGVQGQKVSKYGNDLEVWAGQLSGHRKAVLLLNRGA
TRSASITAAWPDVGIRRGVAVEARDVWKHETLPGWFTGSLTAVVGPHSCKLFVLTPVPS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgagattcagagcctgtgtccgagtacgacggccgcgctcctcctgctggcc
gcctgcctcgccgccgcggtggcagcgctcgacgctgcggactacgccaggccgccgctg
cctgcaggcggaggcggccggcgcgtcctcttcgccaacgggctcgggctgacgccgcag
atggggtggaacagctggaaccatttccagtgcgacatcaacgaggcggtcgtccggagc
accgctgatgcgctcgtcgccatcggacttgcaaaggctggctacacgtatgtcaactta
gatgactgctgggcggattccgagagaaccaaagaggtaggatacatggtcgctaacccc
aagacattcccatccggaatcaaggccctggcagattacgttcacagcaaggggcttaag
cttggcatctactcttccgctgggacaagaacttgcagcaacaggatgcctggatctctg
ggctacgaggagagggatgctaagatgtttgcgtcatggggcgttgactacctgaagtat
gacaactgctacagagacggcacgcctgaaaccgtgaggtttgggcgcatgtcccgagcg
ctggtgaactctggccgcccaatcttctactcgctttgcgaatggggcttcatggaagtt
cccaaatggggcggcatgtacggcaacagctggaggaccaccggcgacatcaacgacaca
tggtcaggcatgctggacaacatcgacctgaacgacgcctacgcccggtacgccaagccc
ggcggctggaacgaccctgacatgctggaggtcgggaacggaggcatggcgtacaacgag
tacgtcgtgcacttcagcctctgggccatcgccaaggctcccctggtcatcggctgcgac
gtgacgagagtctccaatgagacgctcggaatcctctccaacgcggaggtcatcgcgatc
agccaagatcggctgggtgtccaaggacagaaagtgagcaagtacggcaacgatctcgag
gtatgggcagggcagctctcggggcacaggaaggcggtgctgctgctcaaccggggggcc
acgcgctccgcgtccatcaccgcggcatggccggacgtgggcatccgccgcggcgtggcc
gtggaggcgagggacgtctggaagcacgagacgctaccgggctggttcaccggcagcctc
acggcggtggtcgggccgcactcgtgcaagctcttcgtcctcacgcccgttcctagctga

DBGET integrated database retrieval system