KEGG   Zea mays (maize): 100191671Help
Entry
100191671         CDS       T01088                                 

Gene name
AY109534
Definition
LOC100191671
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:zma01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:zma01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:zma00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:zma00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 167 aa AA seqDB search
MWSQIYSEETKKQSIPVITAWQLNERMYGELQGLNKQETADRFGKEQVHEWRRSYDIPPP
NGESLEMCAERAVAYFKDQIIPKLVDGKHVMIAAHGNSLRSIIMHLDKLTSQEVISLELS
TGIPMLYIFKEGKFIRRGSPAGPSEAGVYAYTKNLAQYRQKLDGIVQ
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtggagtcagatatacagtgaagagacaaagaagcagtccattcctgtcataacagct
tggcaattgaatgaacggatgtatggtgagcttcaaggccttaacaaacaagaaactgcc
gatcgatttggtaaagaacaagttcatgaatggcgtcgcagttatgatattcctccccca
aatggcgagagccttgagatgtgtgcagagagagcagttgcttatttcaaagaccaaatt
atacctaaacttgtggatggaaagcatgtaatgatcgctgcccatgggaattcacttcgt
tcaatcataatgcatttggacaagctgacttctcaagaggttatcagccttgagttgtct
actggcattcctatgctgtatatatttaaggaagggaaattcatcaggcgaggaagcccc
gctggaccttctgaagcaggtgtctatgcttataccaagaatttggctcagtacagacag
aagcttgatggcatagttcagtag

DBGET integrated database retrieval system