KEGG   Zea mays (maize): 100191701Help
Entry
100191701         CDS       T01088                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
zma  Zea mays (maize)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100191701
   00500 Starch and sucrose metabolism
    100191701
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     100191701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 595 aa AA seqDB search
MASSSSTTATTSCCPLLLALLWVLMAAHRGHAAAVFTGLVFESPGEAEAFEDALLRQACF
NVSFFLSAGGRREACVSRLDTARGGAGSGPVPVLRAALRDTLGEAVGAAGAVRGLASLSN
HAREEVALRDCVELLGYSVDELGWALDAMAADDTDDGGGLELLDSPGRRSASSRAENDIH
AWLSAALGNQDTCVAGFHGTDGRLLRRVEAAVAQLTQLVSNLLAMHKRLRSITPLRHGPP
KSNSASSGAGDDELPPWVMDVEDEEELVAKRARRAGRTSSTRVDVVVAQDGSGRYRTVSE
AVARAPSHSKRKYVIYVKRGEYHENVEVRKKKTNIVIVGEGMGETVISGSRSFSSGWTTF
RSATFAVSGAGFIARDLTFRNTAGPAAHQAVALRVDSDRSAFFRVAVEGHQDTLYAHSLR
QFYRDCRIAGTVDFVFGNGIVVVQRSLVATLPLAPGQTGSVTAQGRKDPNQNTGFSFHGC
VLEAKYPTYLGRPWKPFSRVVVMESYLGSGIQARGWLEWAAAGSGDHSPGLATLFYGEYR
NYGPGAGVAGRVKWPGYHVIMDAAVASRFTVRRFIDGLAWLPGTGITFTADLFRR
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcgtcgtctacgaccgctactaccagctgctgccccctactgctggcgctc
ttatgggtcctcatggcggcacaccgcggccacgccgccgccgtgttcaccggcctggtc
ttcgagagcccgggtgaggcggaggccttcgaggacgcgctgctgcgccaggcctgcttc
aacgtctccttcttcttgtccgcgggtggccgccgcgaggcctgcgtgtcgcggctcgac
acggcgcggggaggcgcgggcagcgggcccgtgcccgtgctccgcgccgcgctgcgcgac
acgctcggcgaggccgtgggcgccgcgggagcggtccgggggctcgcctcgctgtccaac
cacgcgcgcgaggaggtagcgctgcgcgactgcgtcgagctgctgggatactccgtcgac
gagctcgggtgggcgctggacgctatggccgccgacgacaccgacgacggcggcggcctg
gagctgctggactcgcccggccgccgcagcgcctcaagccgcgccgagaacgacatccac
gcgtggctcagcgcggcgctgggcaaccaggacacctgcgtggccggcttccacggcacc
gacggccgcctgctgcgccgcgtcgaggccgccgtagcgcagctcacgcagctggtcagc
aacctgcttgccatgcacaagcgcctgcgcagcatcacgccgctgcgccacggacctcct
aaaagtaacagcgcctcctccggcgccggcgacgacgagctgccgccgtgggtgatggac
gtcgaggacgaggaggagctcgtcgccaagcgcgcccgccgcgcaggcaggacgtcgtcg
acgcgcgtggacgtcgtggtggcgcaggacggcagcgggcgctaccgcaccgtcagcgag
gcggtggcacgggcgcccagccacagcaagaggaagtacgtgatctacgtcaagcgaggg
gagtaccacgagaacgtggaagtcaggaagaagaagaccaacatcgtcatcgtcggcgag
ggcatgggcgagacggtgatctccggcagccggagcttctccagcggctggaccaccttc
cgcagcgccaccttcgcggtgtccggcgccgggttcatcgcgcgggacctgacgttccgc
aacacggcgggtccggcggcgcaccaggcggtggcgctgcgcgtggactcggaccgctcc
gccttcttccgcgtggccgtggaggggcaccaggacacgctgtacgcgcactcgctccgg
cagttctaccgcgactgccgcatcgccggcaccgtggacttcgtcttcggcaacggcatc
gtcgtggtgcagcgcagcctcgtcgccacgctgccgctggcgcccggccagacgggcagc
gtcaccgcgcagggccgcaaggaccccaaccagaacacgggcttctccttccacggctgc
gtgctggaggccaagtacccgacgtacctgggccgcccgtggaagcccttctcgcgggtc
gtggtcatggagtcctacctgggctctggcatccaggcccgcgggtggctcgagtgggca
gctgctggctcgggggaccacagcccgggcctcgccacgctgttctacggagagtacagg
aactacgggcccggtgcgggcgtcgcgggccgagtgaagtggcctggctaccacgtgatc
atggacgccgccgtcgccagccggttcaccgtcaggcgattcatcgacgggcttgcgtgg
ttgcccggcaccggcatcaccttcacggcggatctattcaggagatga

DBGET integrated database retrieval system