KEGG   Zea mays (maize): 100191846Help
Entry
100191846         CDS       T01088                                 

Gene name
csu815
Definition
LOC100191846
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
zma  Zea mays (maize)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100191846 (csu815)
   00052 Galactose metabolism
    100191846 (csu815)
   00500 Starch and sucrose metabolism
    100191846 (csu815)
   00520 Amino sugar and nucleotide sugar metabolism
    100191846 (csu815)
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100191846 (csu815)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 473 aa AA seqDB search
MATTAVSVDEKLDKLRAEVAKLDQISENEKSGFISLVSRYLSGEAEQIEWSKIQTPTDEV
VVPYDTVASPPEDLEETKKLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVI
QIESLNKKYGCNVPLLLMNSFNTHDDTQKIVEKYSNSNIEIHTFNQSQYPRIVTEDFLPL
PSKGKSGKDGWYPPGHGDVFPSLNNSGKLDILLAQGKEYVFVANSDNLGAIVDIKILNHL
INNQNEYCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVNEFKSIEKFKIFNTNN
LWVNLKAIKRLVEAEALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDKAIGINVPRSRF
LPVKATSDLLLVQSDLYTLVDGFVIRNPSRANPANPSIELGPEFKKVANFLARFKSIPSI
VELDSLKVSGDVWFGSGITLKGKVTIIAKPGVKLEIPDGDVLENKDVNGPEDL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccgcggtgtcggtcgacgagaagctcgataagcttcgcgccgaggtcgcc
aagctcgaccagatcagcgagaacgagaagtccgggttcatcagcctcgtgtcacggtac
ctcagtggggaggcggagcagatcgagtggagcaagatccagacccctacggatgaggtg
gtggtgccctacgataccgtcgcgtcgcctcccgaagatctcgaggagacgaagaagctg
ctggataagctcgttgtgctcaagcttaacggagggctcgggacgaccatgggctgcact
gggcccaagtctgtcattgaagtccgcaatgggttcacattccttgaccttattgtgatt
caaattgagtccctgaacaagaagtatggatgcaatgtccctttacttctgatgaactct
ttcaacacccatgatgacacacagaagattgttgagaagtattccaactccaacatcgaa
attcatactttcaatcagagccagtatcctcgcattgttaccgaggacttcttgccactt
cccagcaaagggaaatctgggaaggatggctggtatcctcctggtcatggtgatgtgttt
ccttctttgaataacagcggaaaacttgacatcttattggctcagggcaaggagtatgtc
tttgttgcaaactcagacaacttgggtgctatagtcgacatcaagatcctaaaccatctg
atcaataaccagaacgagtactgcatggaggttactccaaagacgctggctgacgttaag
ggtggcactctcatctcttacgaaggaagagttcagcttttggagattgcccaagtaccc
gatgagcatgtgaatgaatttaaatcaatcgagaagtttaagatattcaacactaacaac
ttgtgggtgaaccttaaagctatcaagagactcgtagaggctgaggcacttaagatggaa
attattccaaaccccaaggaagttgatggtgtgaaagtccttcaactcgaaaccgcagct
ggtgcagctattcggttcttcgacaaagcgattggaattaatgttccccgctcaaggttt
ctcccagtgaaggctacatctgatctgttgcttgtgcagtctgatctttacaccttggtt
gatggctttgtcatccgcaacccatccagagcgaatccagctaacccttcaattgagctt
ggacctgagttcaagaaggttgccaatttccttgctcggttcaagtccatccccagcata
gttgagcttgacagcttgaaggtgtctggtgatgtctggtttggctctggaattacactc
aagggcaaggtgacaattatcgccaagcctggagtgaagttggagattccagatggagac
gtacttgagaacaaggatgtcaatggccctgaggatctttaa

DBGET integrated database retrieval system