KEGG   Zea mays (maize): 100192108Help
Entry
100192108         CDS       T01088                                 

Definition
uncharacterized LOC100192108
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
zma  Zea mays (maize)
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:zma00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    100192108
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100192108
Protein kinases [BR:zma01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   100192108
Mitochondrial biogenesis [BR:zma03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100192108
  Mitophagy factors
   Other mitophagy factors
    100192108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 503 aa AA seqDB search
MEGAGRDANPLGGYRIGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIRSMEMEEKVK
REIKILRLFMHPHIIRLYEVIDTPADIYVVMEYVKSGELFDYIVEKGRLHEEEARRFFQQ
IISGVEYCHRNMVAHRDLKPENLLLDSKCNIKIADFGLSNVMRDGHFLKTSCGSPNYAAP
EVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPSAR
DLIPRMLVVDPMKRITIREIREHMWFKIQLPRYLAVPPPDTAQQVKKLDEETLNDVIKMG
FDKNQLIESLHNRLQNEATVAYYLLMDNRLRTTSGYLGSEFQESMDPSFSQVHAETPTSA
TEHRQHVFTESPGSGLRQHFASERKWALGLQSRAHPREIISEVLKALQELNVYWKKIGHY
NMKCRWSPGCLESMMHNCDGFSAESAIIETDDLIAKSTRIVKFEIQLYKTRDEKYLLDLQ
RVSGPQLLFLDLCSAFLTQLRVL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggagggagctggaagagatgccaaccctttgggcggttaccgaattggcaaaacccta
ggaatcgggtcgttcggtaaagtgaagatcgcggaacatatattgactggccataaggtg
gcaatcaagatcctcaatcgccgtaagatcagaagcatggaaatggaagagaaagtgaag
agagaaatcaagatactgagattatttatgcatcctcatatcatacgcctttatgaggtg
atagatacacctgctgatatttatgttgttatggagtatgttaaatctggagagttgttt
gattacattgttgagaagggaagactacatgaagaagaagcccggcgcttttttcagcag
atcatatctggtgttgaatattgccataggaacatggttgctcaccgtgatttaaagcca
gagaatcttcttttggattcgaaatgcaacattaagattgctgattttggcttaagtaat
gttatgcgtgatggtcactttcttaagacgagttgtggtagcccgaattatgcagcacct
gaggtcatatctggtaaactatatgctggtcctgaagttgatgtctggagctgcggcgtt
attctttatgctcttctttgtggcactcttccatttgacgatgagaatattccaaacctt
tttaagaaaataaagggtggaatatatacccttcctagtcatttgtcaccttcagcgagg
gacttgattcctagaatgctggttgttgatccgatgaaaaggattacaatacgtgaaatc
cgtgaacatatgtggttcaaaattcaacttccgcgctatttggctgtaccgcctccagac
actgcccaacaagttaagaagctggacgaggaaacccttaatgatgttattaagatgggt
tttgacaagaatcagctaattgaatctctgcacaacagattgcagaatgaggcaacagtt
gcctattatttactcatggacaataggcttcgtacaaccagtggttatcttggatctgag
tttcaagaatctatggacccatctttctctcaagtacatgctgaaacaccaacttcagca
actgaacatcggcagcatgtgtttacagaatctccggggtctggtttgaggcagcatttt
gcatctgaaaggaaatgggcccttggtcttcagtctcgagcacatccacgagaaataata
agtgaagtgcttaaagcactgcaagaactgaatgtttactggaaaaagattggacactac
aacatgaaatgcagatggagtcctggctgccttgagagtatgatgcataactgtgatggc
tttagtgcagagtctgctataattgaaactgatgatctcatagcgaaatcaacccgtata
gtgaagtttgagattcagctttacaaaacgagggatgagaagtaccttcttgacctgcaa
agggtcagtggaccacaactcctctttctggacttgtgttccgcctttctaacgcagctg
agagttctttga

DBGET integrated database retrieval system