KEGG   Zea mays (maize): 100192349Help
Entry
100192349         CDS       T01088                                 

Gene name
asn2, AsnS2
Definition
asparagine synthetase2
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
zma  Zea mays (maize)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:zma00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
3
AA seq 606 aa AA seqDB search
MCGILAVLGCADEAKGSSKRSRVLELSRRLKHRGPDWSGLRQVGDCYLSHQRLAIIDPAS
GDQPLYNEDQSVVVAVNGEIYNHLDLRSRLAGAGHSFRTGSDCEVIAHLYEEHGEEFVDM
LDGVFSFVLLDTRHGDRAGSSFFMAARDAIGVTPLYIGWGVDGSVWISSEMKALHDECEH
FEIFPPGHLYSSNTGGFSRWYNPPWYDDDDDEEAVVTPSVPYDPLALRKAFEKAVVKRLM
TDVPFGVLLSGGLDSSLVATVAVRHLARTEAARRWGTKLHSFCVGLEGSPDLKAAREVAE
YLGTLHHEFHFTVQDGIDAIEDVIYHTETYDVTTIRASTPMFLMSRKIKSLGVKMVISGE
GSDELFGGYLYFHKAPNKEELHRETCRKVKALHQYDCLRANKATSAWGLEARVPFLDKEF
INAAMSIDPEWKMVQPDLGRIEKWVLRKAFDDEEQPFLPKHILYRQKEQFSDGVGYSWID
GLKAHATSNVTDKMLSNAKFIFPHNTPTTKEAYYYRMVFERFFPQKSAILTVPGGPSVAC
STAKAIEWDAQWSGNLDPSGRAALGVHLAAYEHQHDPEHVPAAIAAGSGKKPRTIRVAPP
GVAIEG
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatacttgctgtgctcgggtgcgccgacgaggccaagggcagcagcaagagg
tcccgggtgctggagctgtcgcggcggctgaagcaccggggccccgactggagcggcctc
cggcaggtgggcgactgctacctctctcaccagcgcctcgccatcatcgacccggcctct
ggcgaccagcccctctacaacgaggaccagtcggtggtcgtcgccgtcaacggcgagatc
tacaaccacctggacctcaggagccgcctcgccggcgcaggccacagcttcaggaccggc
agcgactgcgaggtcatcgcgcacctgtacgaggagcatggagaagagttcgtggacatg
ctggacggcgtcttctccttcgtgctgctggacactcgccatggcgaccgcgcgggcagc
agcttcttcatggctgctcgcgacgccatcggtgtgacgcccctctacatcggatgggga
gtcgatgggtcggtgtggatttcgtcggagatgaaggccctgcacgacgagtgtgagcac
ttcgagatcttccctccggggcatctctactccagcaacaccggcggattcagcaggtgg
tacaaccctccttggtacgacgacgacgacgacgaggaggccgtcgtcaccccctccgtc
ccctacgacccgctggcgctaaggaaggcgttcgagaaggccgtggtgaagcggctgatg
acagacgtcccgttcggcgtcctgctctccggcgggctggactcgtcgctggtggcgacc
gtcgccgtgcgccacctcgcccggacagaggccgctaggcgctggggcaccaagctccac
tccttctgcgtgggcctggaggggtcccctgacctcaaggcggccagggaggtggcggag
tacctgggcaccctgcaccatgagttccacttcactgttcaggacggcatcgacgccatc
gaggacgtgatctaccacacggagacgtacgacgtcaccacgatcagggcgagcacgccc
atgttcctcatgtcgcgcaagatcaagtcgctcggggtcaagatggtcatctccggcgag
ggctccgacgagctcttcggaggctacctctacttccacaaggcgcccaacaaggaggag
ttgcaccgagagacgtgtaggaaggttaaggctctgcatcagtacgactgcctgagagcc
aacaaggcgacatcagcttggggcctggaggctcgcgtcccgttcctggacaaggagttc
atcaatgcggccatgagcatcgatcctgagtggaagatggtccagcctgatcttggaagg
attgagaagtgggtgctgaggaaggcattcgacgacgaggagcagccattcctgcccaag
catatcctctacagacagaaggagcagttcagtgacggcgttgggtacagctggatcgat
ggcctgaaggctcatgcaacatcaaatgtgactgacaagatgctgtcaaatgcaaagttc
atcttcccacacaacactccgaccaccaaggaggcctactactacaggatggtcttcgag
aggttcttcccacagaaatctgctatcctgacggtacctggtgggccaagtgtggcgtgc
agcacagccaaggccatcgagtgggacgcacaatggtcaggaaatctggacccctcggga
agggcggcactgggcgtccatctcgccgcctacgaacaccaacatgatcccgagcatgtc
ccggcggccattgcagcaggaagcggcaagaagccaaggacgattagggtggcaccgcct
ggcgttgccatcgagggatag

DBGET integrated database retrieval system