KEGG   Zea mays (maize): 100192351Help
Entry
100192351         CDS       T01088                                 

Gene name
asn4, AsnS4
Definition
asparagine synthetase4
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
zma  Zea mays (maize)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100192351 (asn4)
Enzymes [BR:zma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     100192351 (asn4)
Peptidases [BR:zma01002]
 Cysteine Peptidases
  Family C44
   100192351 (asn4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
9
AA seq 588 aa AA seqDB search
MCGILAVLGCSDCSQARRARILACSRRLKHRGPDWSGLYQHEGNFLAQQRLAIVSPLSGD
QPLFNEDRTVVVVANGEIYNHKNVRKQFTGAHSFSTGSDCEVIIPLYEKYGENFVDMLDG
VFAFVLYDTRDRTYVAARDAIGVNPLYIGWGSDGSVWMSSEMKALNEDCVRFEIFPPGHL
YSSAAGGFRRWYTPHWFQEQVPRTPYQPLVLREAFEKAVIKRLMTDVPFGVLLSGGLDSS
LVASVTKRHLVKTDAAGKFGTELHSFVVGLEGSPDLKAAREVADYLGTTHHEFHFTVQDG
IDAIEEVIYHDETYDVTTIRASTPMFLMARKIKSLGVKMVLSGEGSDELLGGYLYFHFAP
NREELHRETCRKVKALHQYDCLRANKATSAWGLEVRVPFLDKEFVDVAMGMDPEWKMYDK
NLGRIEKWVLRKAFDDEEHPYLPEHILYRQKEQFSDGVGYNWIDGLKAFTEQQVTDEMMN
NAAQMFPYNTPVNKEAYYYRMIFERLFPQDSARETVPWGPSIACSTPAAIEWVEQWKASN
DPSGRFISSHDSAATDRTGDKLAVANGGGHGAANGTVNGNDVAVAIAV
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatcttagccgtgctcggatgctccgactgctcccaggccaggagggctcgc
atcctcgcctgctccagaaggctgaagcacaggggccccgactggtcgggcctctaccag
cacgagggcaacttcctggcgcagcagcggctcgccatcgtctccccgctgtccggcgac
cagccgctgttcaacgaggaccgcaccgtcgtggtggtggccaatggagagatctacaac
cacaagaacgtccggaagcagttcaccggcgcgcacagcttcagcaccggcagtgactgc
gaggtcatcatccccctgtacgagaagtacggcgagaacttcgtggacatgctggacgga
gtcttcgcgttcgtgctctacgacacgcgagacaggacctacgtggcggcacgcgacgcc
atcggcgtcaacccgctctacatcggctggggcagcgacggttccgtctggatgtcgtcc
gagatgaaggcgctgaacgaggactgcgtgcgcttcgagatcttcccgccggggcacctc
tactccagcgccgccggcgggttccgccggtggtacaccccgcactggttccaggagcag
gtgccccggacgccgtaccagccgctcgtccttagagaggccttcgagaaggcggttatc
aagaggctcatgaccgacgtcccgttcggggtcctcctctccggcggcctcgactcctcc
ctcgtcgcctccgtcaccaagcgccacctcgtcaagaccgacgccgccggaaagttcggc
acagagctccactccttcgtcgtcggcctcgagggctcccctgacctgaaggccgcacga
gaggtcgctgactacctcggaaccacccatcacgagttccatttcaccgtacaggacggc
atcgacgcgatcgaggaggtgatctaccacgacgagacgtacgacgtgacgacgatccgg
gccagcacgcccatgttcctgatggctcgcaagatcaagtcgctgggcgtgaagatggtg
ctgtccggggagggctccgacgagctcctgggcggctacctctacttccacttcgccccc
aacagggaggagctccacagggagacctgccgcaaggtgaaggccctgcaccagtacgac
tgcctgcgcgccaacaaggcgacgtcggcgtggggcctggaggtccgcgtgccgttcctc
gacaaggagttcgtcgacgtcgcgatgggcatggaccccgaatggaaaatgtacgacaag
aacctgggtcgcatcgagaagtgggtcctgaggaaggcgttcgacgacgaggagcaccct
tacctgcccgagcatattctgtacaggcagaaagaacagttcagtgacggagtgggctac
aactggatcgatggactcaaagccttcactgaacagcaggtgacggatgagatgatgaac
aacgccgcccagatgttcccgtacaacacgcccgtcaacaaggaggcctactactaccgg
atgatattcgagaggctcttccctcaggactcggcgagggagacggtgccgtggggcccg
agcatcgcctgcagcacgcccgcggccatcgagtgggtggagcagtggaaggcctccaac
gacccctccggccgcttcatctcctcccacgactccgccgccaccgaccgcaccggcgac
aagctggcggtggccaacggcggcgggcacggcgcggcgaacggcacggtcaacggcaac
gacgtcgctgtcgcgatcgcggtgtaa

DBGET integrated database retrieval system