KEGG   Zea mays (maize): 100192478Help
Entry
100192478         CDS       T01088                                 

Gene name
pco064611a
Definition
LOC100192478
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100192478 (pco064611a)
   01230 Biosynthesis of amino acids
    100192478 (pco064611a)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100192478 (pco064611a)
   00030 Pentose phosphate pathway
    100192478 (pco064611a)
   00051 Fructose and mannose metabolism
    100192478 (pco064611a)
   00052 Galactose metabolism
    100192478 (pco064611a)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100192478 (pco064611a)
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100192478 (pco064611a)
Protein phosphatases and associated proteins [BR:zma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100192478 (pco064611a)
Messenger RNA biogenesis [BR:zma03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100192478 (pco064611a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
8
AA seq 318 aa AA seqDB search
MYGVSSVVGIEGGYKGFYSKNTVALTPKSVNDIHKRGGTVLGTSGGGHDTAKIVDCLQDR
GINQVYIIGGDGTQKGASVIYEEVRRRGLKCSVVGVPKTIDNDIAVIDKSFGFDTAVEEA
QRAINAAHVEAESAENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGGL
LEFVERRLKDNGHMVIVVAEGAGQDLIARSMNFVDTQDASGNKLLLDVGLWLSQKIKDHF
KKKPSFPITLKYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHA
YIPFYVSRRPNAVEHTAS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtatggcgtctccagcgtcgtcggcatagagggtggatacaagggtttctattctaaa
aacactgttgcgttgacaccaaagtcggtgaacgacatccataagagaggcgggactgtc
ctcggaacctcaggaggagggcatgacactgccaaaatcgttgattgtcttcaggaccgt
ggcattaaccaggtctatattatcggaggcgatggcactcagaaaggcgcttctgtaatt
tatgaggaagtccggagacggggtctcaagtgctctgttgtcggtgtcccaaagactatt
gataacgacatcgcggtgattgacaagtcgtttggatttgacactgctgtggaggaggcc
cagagggccatcaatgctgctcatgtcgaggctgaaagtgcggagaacggcatcggtgtc
gtgaagcttatgggccgcaacagtggttttatcgcgatgtacgcgactctagctagccgt
gatgtggactgttgtttaatcccggagtcacccttctacctcgaagggaagggaggactc
ctcgagttcgtcgagaggcggctcaaggacaacggccacatggtcatcgtggtggccgag
ggtgctgggcaggacctcatcgcgagaagtatgaatttcgtggacacccaagacgcttct
ggaaacaagctgcttctggatgtcggcctttggctatcccagaagataaaggatcatttc
aagaagaagcccagcttcccgataaccctcaagtacatcgacccgacctacatgatccgc
gccgtccggtcgaatgcttctgacaacgtctactgcactctgctggcccacagcgccctc
catggcgccatggcggggtacaccggcttcacggtcgctccggtcaacggcaggcacgcc
tacatcccgttctatgtaagtcgaaggccgaatgcagttgagcacacagcttcttga

DBGET integrated database retrieval system