KEGG   Zea mays (maize): 100192478Help
Entry
100192478         CDS       T01088                                 

Gene name
pco064611a
Definition
LOC100192478
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:zma01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:zma01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:zma00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:zma00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:zma00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:zma00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 318 aa AA seqDB search
MYGVSSVVGIEGGYKGFYSKNTVALTPKSVNDIHKRGGTVLGTSGGGHDTAKIVDCLQDR
GINQVYIIGGDGTQKGASVIYEEVRRRGLKCSVVGVPKTIDNDIAVIDKSFGFDTAVEEA
QRAINAAHVEAESAENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGGL
LEFVERRLKDNGHMVIVVAEGAGQDLIARSMNFVDTQDASGNKLLLDVGLWLSQKIKDHF
KKKPSFPITLKYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHA
YIPFYVSRRPNAVEHTAS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtatggcgtctccagcgtcgtcggcatagagggtggatacaagggtttctattctaaa
aacactgttgcgttgacaccaaagtcggtgaacgacatccataagagaggcgggactgtc
ctcggaacctcaggaggagggcatgacactgccaaaatcgttgattgtcttcaggaccgt
ggcattaaccaggtctatattatcggaggcgatggcactcagaaaggcgcttctgtaatt
tatgaggaagtccggagacggggtctcaagtgctctgttgtcggtgtcccaaagactatt
gataacgacatcgcggtgattgacaagtcgtttggatttgacactgctgtggaggaggcc
cagagggccatcaatgctgctcatgtcgaggctgaaagtgcggagaacggcatcggtgtc
gtgaagcttatgggccgcaacagtggttttatcgcgatgtacgcgactctagctagccgt
gatgtggactgttgtttaatcccggagtcacccttctacctcgaagggaagggaggactc
ctcgagttcgtcgagaggcggctcaaggacaacggccacatggtcatcgtggtggccgag
ggtgctgggcaggacctcatcgcgagaagtatgaatttcgtggacacccaagacgcttct
ggaaacaagctgcttctggatgtcggcctttggctatcccagaagataaaggatcatttc
aagaagaagcccagcttcccgataaccctcaagtacatcgacccgacctacatgatccgc
gccgtccggtcgaatgcttctgacaacgtctactgcactctgctggcccacagcgccctc
catggcgccatggcggggtacaccggcttcacggtcgctccggtcaacggcaggcacgcc
tacatcccgttctatgtaagtcgaaggccgaatgcagttgagcacacagcttcttga

DBGET integrated database retrieval system