KEGG   Zea mays (maize): 100192559Help
Entry
100192559         CDS       T01088                                 

Definition
(RefSeq) acyl-protein thioesterase 2
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
zma  Zea mays (maize)
Pathway
zma00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100192559
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100192559
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 FSH1 Hydrolase_4 Peptidase_S9 Abhydrolase_6 DLH Lipase_3 LIP
Motif
Other DBs
NCBI-GeneID: 100192559
NCBI-ProteinID: NP_001297764
UniProt: B6T1C9 C0PKE3
Structure
PDB: 

Jmol
Position
8
AA seq 255 aa AA seqDB search
MSYGGSSSLAPGAKRPFEYGRTHVVRPKGTHKATIVWLHGLGDNGTSWSQLLETLPLPNI
KWICPTAPSRPVSLFGGFPCTAWFDVADLSEDAPDDTEGMDASAAHVANLLSTEPADIKL
GVGGFSMGAATALYSATCFAHGKYGNGNPYPVNLSLAVGLSGWLPCARTLKNRIEASPEA
AQRASTIPLLLCHGKADDVVLYKHGQRSTDALKANGFSNVLFKSYNSLGHYTVPEEMDEV
CKWLTANLGLGTSSS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagctacggcggcagcagctccctcgcgcccggtgccaagaggccgttcgagtacggg
agaacgcatgtggtgaggcccaagggcacgcacaaggccaccattgtctggctccacggc
cttggtgacaatggaaccagctggtctcaactgctggaaacgcttccccttcctaatata
aaatggatatgcccaactgcaccttcaagacctgtgtcattgtttggcgggttcccctgc
acagcatggtttgatgttgctgacctttctgaggatgctcccgatgacactgaggggatg
gatgcctcagcagcacatgttgcaaatttgttgtcaactgagcccgctgatatcaagctt
ggtgttggtggctttagtatgggtgctgctactgctctgtactctgcaacttgctttgct
catggaaaatatgggaacggcaatccataccctgtgaacctaagtcttgccgttggtctt
agtggctggcttccatgtgccaggaccttgaagaacagaattgaagcctcaccagaggct
gcacaaagggcttcaacaatacctcttttgctctgtcatggaaaagctgatgatgtagtt
ctctacaagcacgggcagagatctactgatgccttgaaggcaaatggcttttccaatgtg
ctcttcaagtcatacaatagtcttggtcactacactgttccagaggagatggatgaagtt
tgcaaatggctcacagcaaatttggggctcggcacttcgtcatcttga

DBGET integrated database retrieval system