KEGG   Zea mays (maize): 100192559Help
Entry
100192559         CDS       T01088                                 

Definition
acyl-protein thioesterase 2
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
zma  Zea mays (maize)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:zma00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 255 aa AA seqDB search
MSYGGSSSLAPGAKRPFEYGRTHVVRPKGTHKATIVWLHGLGDNGTSWSQLLETLPLPNI
KWICPTAPSRPVSLFGGFPCTAWFDVADLSEDAPDDTEGMDASAAHVANLLSTEPADIKL
GVGGFSMGAATALYSATCFAHGKYGNGNPYPVNLSLAVGLSGWLPCARTLKNRIEASPEA
AQRASTIPLLLCHGKADDVVLYKHGQRSTDALKANGFSNVLFKSYNSLGHYTVPEEMDEV
CKWLTANLGLGTSSS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagctacggcggcagcagctccctcgcgcccggtgccaagaggccgttcgagtacggg
agaacgcatgtggtgaggcccaagggcacgcacaaggccaccattgtctggctccacgga
cttggggacaatggaaccagctggtctcaactgctggaaacgctcccccttcctaatata
aaatggatatgcccaactgcaccttcaagacctgtgtcattgtttggcgggttcccctgc
acagcatggtttgatgttgctgacctttctgaggatgctcccgatgacactgaggggatg
gatgcctcagcagcacatgttgcaaatttgttgtcaactgaacccgctgacatcaagctt
ggtgttggtggctttagtatgggtgctgctactgctctgtactctgcaacttgctttgct
catggaaaatatgggaacggcaatccataccctgtgaacctaagtcttgccgttggtctt
agtggctggcttccatgtgccaggaccttgaagaacagaattgaagcctcaccagaggct
gcacaaagggcttcaacaatacctcttttgctctgtcatggaaaagctgatgatgtagtt
ctctacaagcacgggcagagatctactgatgccttgaaggcaaatggcttttccaatgtg
ctcttcaagtcatacaatagtcttggtcactacactgttccagaggagatggatgaagtt
tgcaaatggctcacagcaaatttggggctcggcacttcgtcatcttga

DBGET integrated database retrieval system