KEGG   Zea mays (maize): 100192767Help
Entry
100192767         CDS       T01088                                 

Definition
uncharacterized LOC100192767
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
zma  Zea mays (maize)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:zma00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:zma00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 332 aa AA seqDB search
MPAGRSAPARGAAVAAMLLLTMLARLPCLEAQSSRRPTVLTVDMTGKGDYRTIQEAIDAI
PAAANNSTSAAIVTINVNPGIYTEKVVVNKAGVSLVGRSATSTIVTWSGPWNQNHQSEFA
LYVQATDFVAKGLTFQNTLGSKDNGPAVAAKVDADKAAFYDCRFLSYQDTLLDATGRHYY
RGCYIEGATDFIFGTGKAFFESCHLHSTSDAKGAFTAQRRSTESENAGFSFFRCESTGTG
VATAILGRPWGPYARVVFALCNMSNTVAPEGWNNWDNTANEKTAFFGQFQCYGQGSGTQG
RVTWAHNNLSPNEAAPFLTNAWVDGQDWLRPQ
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctggaagaagcgcgccggcaaggggtgcagcagtggcagcaatgctgctgctg
actatgcttgcacggctaccatgcctagaagcccaaagctcgcgccgacctactgtcctc
actgtagacatgacaggcaagggagattacagaaccatacaggaggcgatcgacgccatt
cctgccgccgcaaacaactcgaccagcgcggccatcgtcacgatcaacgtcaaccctggg
atatacacggagaaggtcgttgtcaacaaggctggagtctctctagtcgggaggagcgcc
acctcaaccatagttacctggagtggaccctggaaccagaaccaccagtctgagtttgct
ctctacgtacaggcaaccgactttgtcgccaagggcttaacatttcagaacacgttaggg
agtaaggataatggcccggcggtggctgctaaagttgacgccgacaaggcggcgttctat
gactgtagattcctatcgtatcaggacaccttgctggatgcaacagggcgccactactat
cgtgggtgctacatagaaggcgccactgattttatattcggcacaggaaaagcctttttt
gagagctgccacttgcactctacctcggacgccaaaggagcattcacagcgcagaggcgg
tccacggagtcggagaacgccggtttcagtttttttaggtgcgagtcgaccggcacagga
gtcgccacggctatcctagggcggccatggggcccttacgcccgggtcgtgtttgccctc
tgcaacatgtctaacacggtggcgcccgagggctggaacaactgggacaacacggcgaat
gaaaagacggcgttctttggacaatttcagtgctacggccagggatccggaacacaaggc
cgtgttacgtgggcgcacaacaacctctctccaaatgaagctgcgcctttcctcaccaat
gcttgggttgatggccaagattggcttcgtccgcagtag

DBGET integrated database retrieval system