KEGG   Zea mays (maize): 100192907Help
Entry
100192907         CDS       T01088                                 

Definition
uncharacterized LOC100192907
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
zma  Zea mays (maize)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100192907
Enzymes [BR:zma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     100192907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 297 aa AA seqDB search
MAFSSSLAPFFPPSGTFRAHPARRLRADAPGRFVASCLPPPDVVVTREQGKNARLISALE
KHNVHPLELPLIKHVEGPDTDRLLDVLRNDKFDWIIVTSPEAAAVFLQGWKAAGSPKVRV
AVVGEGTARVFHEVSESDDQSLELAFSPSKALGKVLASELPRSNRNSCKVLYPASAKAGH
EIEDVLSERGFDVTRLNTYTTVPVEDVDPLTLNLAISAPVVALASPSALRAWLNLISKSD
NWNNSVACIGETTASAAKKLGLKSIYYPTTPGLEGWVESILEALRVHRTASKEAPKR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggccttctcttcgtcactggcgccgttcttcccaccttctggaaccttccgagcccat
cccgctaggaggctgcgggccgatgcacccgggagattcgtggcgtcctgcttgccccct
cccgacgtcgtggtgacgcgcgagcagggaaagaacgccaggctcatctccgcgctggaa
aagcataatgtacaccctctggaacttcctcttattaagcatgttgaaggccctgataca
gataggcttttagatgtcctacgtaatgacaagttcgactggattattgtaacctctcct
gaggcagctgcagtgttccttcagggatggaaggctgctggaagtcctaaggtgcgagta
gctgttgttggagaaggaactgcaagggtttttcatgaagtgtcagaatctgatgatcaa
tctctagagcttgcattttcaccttccaaagctttgggtaaagtcttggcttcagagctt
ccaagaagcaacaggaactcatgtaaagtattgtaccctgcatctgcaaaggctggccat
gaaattgaggatgtgctatcagaacgaggatttgacgtgacccgactgaatacatataca
actgttcctgtagaagatgtcgacccgctgacattaaaccttgctatatcagctccagtt
gttgcgttagcttctccttctgcactgagggcatggctaaatcttatctcaaaatctgat
aactggaacaactccgtcgcctgcatcggtgagaccactgcgtctgcagcgaagaaactg
ggcctgaagagcatatattacccaacgacccctggacttgaggggtgggtcgagagcatt
ctcgaggcgctcagagtccacaggacagcatcaaaagaggccccaaaacgttga

DBGET integrated database retrieval system