KEGG   Zea mays (maize): 100192922Help
Entry
100192922         CDS       T01088                                 

Gene name
si605019d10
Definition
(RefSeq) uncharacterized protein LOC100192922
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
zma  Zea mays (maize)
Pathway
zma00564  Glycerophospholipid metabolism
zma01100  Metabolic pathways
Module
zma_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100192922 (si605019d10)
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100192922 (si605019d10)
    2.7.1.82  ethanolamine kinase
     100192922 (si605019d10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Haspin_kinase Pkinase DUF1679
Motif
Other DBs
NCBI-GeneID: 100192922
NCBI-ProteinID: NP_001131578
UniProt: B4FD46
Position
8
AA seq 359 aa AA seqDB search
MAAADPPPRGEAAPALKRSASIDRIPADARRILHRLAGDLWGGDVDPGALAVSQLRGAMT
NEVFRITWPGGEAEGNGPRKVLVRIYGRGVEVFFDRADEVRTFECMSRHGQGPRLLGRFA
NGRVEEFINARTLSAADLRDPEMSTLIARKLREFHDLDMPGPRDVSLWQRLKRWLGEARD
RCSQEESNQFQLNKLGDEISVLEKTLSGLQQSVGFCHNDLQYGNIMIYEETRQVTLIDYE
YASFNPVAFDIANHFCEMAADYHTATPHVLDFTKYPDTGEQRRFVEAYLSSAGEKPTDGE
VEELLGLIAKYTLASHLFWGLWGIISAHVNEHIDFEYKEYARQRLDQYWQTKPRILGPK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcggacccgccgccgcgcggggaggccgcgcccgcgctgaagcggagcgcc
agcatcgaccggataccggcggacgcgcgccgcatcctgcaccgcctcgccggggacctc
tggggcggcgacgtggaccccggcgcgctggccgtgtcgcagctcaggggcgccatgacc
aacgaggtcttccggatcacctggcccggcggcgaggccgagggcaacggcccgcgcaag
gtgctcgtgcgcatctacggccggggcgtcgaggtcttcttcgaccgcgccgacgaggtc
cgcaccttcgagtgcatgtcgcgccacggtcaggggccccgcctcctgggccgcttcgcc
aacggccgcgtcgaggagttcatcaacgccaggaccctctccgccgcggatctgcgcgac
ccggagatgtccacgctgattgccaggaagctgcgcgagtttcacgatctcgacatgcct
ggacctagggacgtgtcattgtggcagaggctcaagcggtggcttggggaggctcgtgac
aggtgttctcaggaagagtctaaccaatttcagctgaataaactaggtgatgagatttca
gtgctggagaagacgctctcggggctccaacagtcagtaggattttgccataacgatctg
caatatgggaatattatgatatatgaagagaccagacaagtcaccttgattgactatgag
tatgcgagttttaacccagttgcattcgacattgctaatcacttctgtgagatggctgct
gattaccatacagcaacaccacatgtgttggattttacgaaatatcctgacactggggag
cagagaagattcgttgaggcataccttagctctgcaggtgaaaagccaacggatggggaa
gttgaagaactgctagggttgattgcaaagtacactcttgcgagccatctcttctggggc
ctgtggggaataatctcggcgcacgtgaacgaacatatcgacttcgagtacaaggagtat
gcaaggcagcgcttggatcagtactggcaaacaaagcctcgaattcttggacccaagtga

DBGET integrated database retrieval system