KEGG   Zea mays (maize): 100193000Help
Entry
100193000         CDS       T01088                                 

Gene name
gpm397a
Definition
LOC100193000
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100193000 (gpm397a)
   01230 Biosynthesis of amino acids
    100193000 (gpm397a)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100193000 (gpm397a)
   00051 Fructose and mannose metabolism
    100193000 (gpm397a)
   00562 Inositol phosphate metabolism
    100193000 (gpm397a)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100193000 (gpm397a)
Enzymes [BR:zma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100193000 (gpm397a)
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100193000 (gpm397a)
  Exosomal proteins of bladder cancer cells
   100193000 (gpm397a)
  Exosomal proteins of melanoma cells
   100193000 (gpm397a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
2
AA seq 298 aa AA seqDB search
MAAAPSSLASSHLSPIAAVSTPAVPHQLRIGCSRRRAGRIVAMAGSGKFFVGGNWKCNGT
KDSISKLVSELNAATLETDVDVVVAPPFIYIDQVKNSLTGRIEVSAQNVWIGKGGAYTGE
ISAEQLVDIGCQWVILRHSERRHIIGENDEFIGKKAAYALSQNVKVIACIGELLEEREAG
KTFDVCFRQMKAFADSISNWADVVIAYEPVWAIGTGKVATPEQAQEVHAAVRNWLKTNIS
PDVASSTRIIYGGSVNAANCAELAKKEDIDGFLVGGASLKGPDFATIINSVTAKKVAA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggcgccgtcatccctcgcgtcctcccacctctccccaatcgcggcggtgtcc
actcccgccgtcccacatcagcttcgcatcggctgctcccgccgccgcgccgggcgcatc
gttgccatggctggatccggcaagttcttcgtcggaggcaactggaagtgcaatggaaca
aaggactccattagcaaacttgtctctgaattgaatgctgctacccttgaaactgatgta
gatgttgtggtggcacctccatttatctatattgatcaggttaagaattcactaactggt
cgcattgaggtttctgctcagaatgtgtggattggaaaaggaggagcctacaccggagag
atcagtgccgaacaactggtggacatcggctgtcaatgggttattcttcgacactctgag
cgtagacatattattggtgaaaatgatgagtttattggaaagaaggctgcatatgcattg
agccaaaatgttaaggttattgcctgcataggagagctgctggaagagagggaagcaggc
aaaacttttgatgtatgttttaggcagatgaaggcttttgcagatagtatttcaaactgg
gcagatgttgtaattgcatacgagcctgtttgggctattggaaccggaaaagttgctact
cctgaacaagcccaggaagttcatgctgctgtacgcaattggctgaagaccaacatatca
cccgatgttgcctctagcactcgaataatctatggaggttctgtgaatgcagccaactgt
gcggagctagcaaagaaagaagatattgatggttttcttgttggtggtgcctctttgaag
ggccctgatttcgccaccattatcaactcggtgaccgctaagaaagttgcagcctga

DBGET integrated database retrieval system