KEGG   Zea mays (maize): 100193019Help
Entry
100193019         CDS       T01088                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100193019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 280 aa AA seqDB search
MCLAAACASATLARRLSPSTALPRRFLLGAPTRPSPPPPLLRRCLPFHFYHMAQYWTQPS
LDRNKAMVEYLKQYGAVRTDKVKEVMETIDRALFVPEGTPYIDSPMPIGFNATISAPHMH
ATCLELLKDHLQPGMHALDVGSGSGYLTACFAMMVGPEGRAVGIEHVPEIVASSVENVQR
SAAAPLLRDGSLSFHVTDGRLGFPDAAPYDAIHVGAAAPEIPQPLLDQLKPGGRMVIPVG
TYSQDLQVVDKNTDGSFSVRSDAAVRYVPLTSRAAQLQGP
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctcgccgccgcgtgcgcgtccgccaccctagcccgccgcctctcgccctccacc
gcgctcccgcgccgcttcctcctcggcgcccccacgaggccttccccgccaccgcctctg
ctgcggcgctgcctcccgttccacttctaccatatggcgcaatattggactcaaccatca
ctggacaggaacaaagctatggttgagtacctaaagcagtatggtgctgttagaactgat
aaagtgaaggaagtaatggaaacgattgatagagcactatttgtaccagagggtacccct
tacattgacagtcctatgcctattggtttcaacgcgacgatatctgctcctcacatgcat
gcgacctgcttagagctattgaaggatcatttgcaaccaggaatgcatgctctggatgtc
ggatcaggtagtggctacctgacagcttgttttgccatgatggttggaccagaaggccgt
gcagtgggaattgaacacgttcccgagatcgttgcttcttctgttgaaaatgtgcagaga
agtgctgcagctccactactgagggatggatcgctctcttttcatgttacagatggcagg
cttggctttccagacgcggcaccctacgacgctatccatgttggtgcagcggcacctgag
atccctcagcctctgcttgatcagctaaagcctggcggccggatggtgataccggttggc
acctactcccaggacctgcaggtggtggacaagaacacggatggatcattcagcgtccgg
agcgacgcggctgtgcgctacgtcccactgaccagccgcgccgcgcagttgcagggcccc
taa

DBGET integrated database retrieval system