KEGG   Zea mays (maize): 100193091Help
Entry
100193091         CDS       T01088                                 

Definition
uncharacterized LOC100193091
Orthology
K07204  
regulatory associated protein of mTOR
Organism
zma  Zea mays (maize)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 197 aa AA seqDB search
MSSILVWDLDKEQLLSTIQSTADTAISSLSTSQVRSGHFAAGFADGSVRIYDVRSPDRFV
YVARPHAPRTEKVVSIGFQPGFDPYKIVSASQAGDIQFLDVRRAAEPYLTIEAHRGSLTA
LVVHRYAPVVASGSAKQMIKVFSLGGEQLTIIGYLPSFMGQRIGSVNCLSFHPYKSLLAA
GAGDNALVSIYAEENYK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccatcttggtatgggatcttgacaaggaacaacttctcagcaccattcagtca
actgctgatactgccatttcttccctgtctacatctcaggttcgctccggacactttgct
gctggttttgctgatggttctgtcaggatatatgatgttcgctctcctgataggttcgtc
tatgtggccaggccacatgccccaagaacagaaaaggttgtgagcataggatttcaacct
gggtttgatccatacaagattgtaagtgcatctcaagctggagacatccagtttcttgat
gttagaagggcagcagaaccctacctgactattgaggcacacaggggttcacttacagca
ttagtggttcatcgttatgccccagttgttgctagtggctcagccaagcaaatgattaaa
gtgtttagtcttggtggggagcagttgacgataattgggtacctgccatcttttatgggc
caaagaataggcagtgtaaattgcctttcttttcacccatacaagtcactcctggctgct
ggtgctggtgacaatgctctggtctctatctatgctgaggaaaattacaagtaa

DBGET integrated database retrieval system