KEGG   Zea mays (maize): 100193497Help
Entry
100193497         CDS       T01088                                 

Definition
uncharacterized LOC100193497
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100193497
Peptidases [BR:zma01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100193497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 504 aa AA seqDB search
MGKFMHDNPMLSCSEVNRHHYSLAAVAVGLGLGVAGLCKALYSGLSIPWVSPRNLFSGSG
RAYYVGGLRNLGNNCFLNVILQALASCDGFISFLDNLLATDGLLPEEKAVRMPLLLALSS
LLEDLIIVRDERTVLNPHGVMHALSLYVGHFNLTRQQDASEAFLHLLISLRDEFAHCYVP
HRSSLADITLSDSKVYKQREGNLPECKRWKQNLFGPFDGTVGSILSCRNCSSVLSLDFEN
FHCLPLSPVLNANGDITSGCSLVDCLKYFTVVEHLDNYRCDRCWHIIAAKYLSLRSEVDE
EKVSKLQSCVDYGTCSCRDMFPLESLPCSSSSRATKQLIISQCPKILCIHFLRASVGLDG
EPIKHQGHISFPLLLNLSPFTGGASSAGPLAMNAQRDGQQALHLYRQLNMQANADVSSSS
SSPPQLSRSKLYGLAAVVEHYGKCGGGHYAVYRRVASNPDPDDPGKPVAGLGKRWFYISD
GYVSEVPEEDVLRAEATLLFYERL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggggaagtttatgcatgacaatccaatgctatcatgtagtgaagtaaacagacatcac
tatagtcttgcggcagttgctgtcggtttgggactaggagttgccgggttatgcaaggca
ttgtatagtggtctgtccataccatgggtttctccaaggaatttgttttcgggatcaggg
agggcatactatgttggaggtctgcgaaatcttggcaacaattgctttcttaatgtcatc
ctccaggcacttgccagctgtgatggttttatttcctttctagataatttgcttgcaact
gatggcttgctacctgaagaaaaggctgtaagaatgcctcttcttcttgctttaagttct
ctcttggaagacttaatcatagttcgagatgaaaggactgtgttgaatccacatggagta
atgcatgctttgagtttgtatgttggtcacttcaatctgaccagacagcaggatgcttca
gaagcttttctccatcttctgatctcattgagggatgaatttgcccattgttatgtacca
cataggagttctctggcagacatcaccctttctgactccaaagtatacaagcaaagggaa
ggtaacctgcctgaatgcaagcgctggaaacaaaacctatttggcccctttgatgggaca
gttggcagcatattgtcttgcagaaactgttcttctgtgctgtcattggacttcgagaat
ttccactgcttgcctctttcgccagtccttaatgcaaatggagatattaccagtgggtgt
agtttggtggattgcctaaagtacttcactgtggtggagcatcttgacaactatcgttgt
gaccggtgttggcacatcattgctgccaaatatctttctcttagatcagaagttgatgag
gaaaaggttagcaagcttcaatcctgtgtcgactatggcacttgcagttgcagggatatg
ttccccctggagtcactgccatgttcatcatcttcacgagcaacaaagcagctgattatc
agtcagtgcccgaagattctgtgcattcattttctacgcgcttcagtcggtcttgacggc
gagcccatcaaacatcagggacatatttctttccctttgcttctcaatctgtccccgttt
acgggaggcgcgtcgagtgctggacctttagcaatgaatgcgcaaagagatggccagcaa
gctctccatctataccggcaactgaatatgcaggctaatgctgacgtgtccagtagttca
tcatcaccaccgcagctatcaaggagcaagttatacggtctcgcggccgtcgtggagcac
tacgggaagtgtggaggagggcactacgcagtctacaggagagtcgcgtcgaatcctgac
cctgatgatccaggcaaacctgttgcaggccttggcaagcggtggttttacatctcagac
ggctacgtgtcagaagttccagaggaggatgtactgcgcgcggaggccacgctccttttc
tacgagagattgtag

DBGET integrated database retrieval system