KEGG   Zea mays (maize): 100193501Help
Entry
100193501         CDS       T01088                                 

Gene name
CHC2, GRMZM5G804382
Definition
(RefSeq) clathrin heavy chain 2
  KO
K04646  
clathrin heavy chain
Organism
zma  Zea mays (maize)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:zma00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100193501 (CHC2)
Membrane trafficking [BR:zma04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    100193501 (CHC2)
Exosome [BR:zma04147]
 Exosomal proteins
  Proteins found in most exosomes
   100193501 (CHC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 318 aa AA seqDB search
MNHSPDAWDHMQFKDVCVKVANVELYYKAVHFYLQEHPDLINDMLNVLALRLDHTRVVDI
MRKAGQLHLVKPYMVAVQSNNVSAVNEALNELYVEEEDYERLRESVDMHDNFDQIGLAQK
LEKHELLEMRRIAAYIYKKAGRWKQSIALSKKDNMYKDCMETCSQSGDRELSEDLLVYFI
EQGKKECFASCLFICYDLIRPDVALELAWMNNMLDFAFPYLLQFIREYTSKVDDLVKDRI
ESQNEERVKEKEEKDLVAQQNMYAQLLPLALPAPPMPGMGGPPPPMGGMGMPPMGGMGMP
PMGPGPMPAFGMPAMGSY
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaccactctcctgatgcatgggatcatatgcagttcaaggatgtttgcgttaaagtt
gcaaacgttgagctatattacaaggcagttcacttctatttgcaagagcatcctgatctc
atcaatgatatgctgaatgtgcttgcacttcgtttagatcataccagagttgtagacata
atgcgcaaggctggtcaattgcatcttgtgaaaccatatatggttgcagttcagagtaat
aatgtctctgctgtgaatgaagccttgaatgagctttatgttgaagaggaagactatgag
agactccgtgaatcagttgacatgcatgacaactttgaccaaataggtcttgcccagaag
ctggagaagcatgaattgcttgagatgaggaggattgctgcctacatttacaagaaggct
ggcaggtggaagcaatccattgctctatcaaagaaagataacatgtacaaggattgtatg
gagacatgctcacaatctggtgaccgtgaactgtcagaggacttgcttgtgtattttatc
gagcagggtaagaaagaatgctttgcttcttgcctcttcatttgctacgacctgatccgg
ccggatgtcgctcttgagcttgcgtggatgaacaacatgttggactttgccttcccatac
ctgttgcagttcatccgtgaatacactagcaaggtggatgatttagtgaaggacagaatt
gagtcacagaatgaagaaagagtcaaagagaaggaggagaaagatcttgtggctcagcag
aacatgtatgcgcaactgcttcctcttgctttgcctgctccgccgatgcctggcatgggt
ggccctccacctccaatgggtgggatgggcatgcctccaatgggtggaatgggtatgccg
ccgatgggccctggtccgatgccagcattcgggatgccagcaatgggaagctactga

DBGET integrated database retrieval system