KEGG   Zea mays (maize): 100193522Help
Entry
100193522         CDS       T01088                                 

Gene name
pco095943
Definition
LOC100193522
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
zma  Zea mays (maize)
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100193522 (pco095943)
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    100193522 (pco095943)
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     100193522 (pco095943)
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100193522 (pco095943)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 523 aa AA seqDB search
MAGKGKEVYVAAIDQGTTSTRFIVYDRHAKPVASHQLEFKQHYPEAGWVEHDPMEIIETV
KVCMKEAVGKAKDGKHNVVAGLKAIGITNQRETTVMWSKSTGRPLYNAIVWMDARTSPVC
RRLENELSGGRTHFVETCGLPISTYFSALKLLWLMENVDAVKDAVRTGDALFGTIDTWLI
WNLTGGVAGGQHVTDCSNASRTMLMNLKTLDWDKPTLAVLGVPVEILPKIISNSEKIGVV
AKEFPFAGVPISGCLGDQHAAMLGQLCQKGEAKSTYGTGAFILLNTGEEPTQSSHGLLST
IAYKLGPAAPTNYALEGSIAIAGAAVQWLRDSLGIIQSAAEIEKLAETVPDSGGVYFVPA
FNGLFAPWWRDDARGICIGITRFTNKGHIARAVLESMCFQVNDVLSSMHKDAGEAGEVKS
AEGEFLLRVDGGATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAAGVWTKEKV
FAGLHKENTTVFRPKLDEAHRKKRADSWYKAVSRSFDLADLSL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaaagggaaggaggtgtacgtggccgccatcgaccagggcaccacaagcacc
cggttcatcgtctacgaccgccacgccaaacccgtcgcatcgcaccagctcgagttcaag
caacactacccggaggcagggtgggttgagcatgatcctatggagattatagagactgtt
aaggtgtgtatgaaagaggcagttggcaaagccaaagatggtaaacacaatgtggttgct
ggtttgaaggccattgggatcacaaatcagagggaaaccactgttatgtggagtaaatcc
actggccgtccactgtataatgctattgtgtggatggatgctcgcacaagccctgtttgc
aggagattggaaaatgagctgtcaggcggtaggacccacttcgtggagacatgcgggttg
ccaatcagtacctatttcagtgctctgaaattattatggttgatggaaaatgtggatgct
gtcaaggatgcagtccggactggtgacgctttattcggcacgatcgacacctggttgatt
tggaaccttacaggaggtgttgctggtgggcagcatgtcacggattgctcaaatgcatct
cgtacaatgcttatgaatctaaagacacttgactgggataagccaacacttgctgtgtta
ggagttcctgttgagattttgccaaagattatcagtaattcagagaaaatcggtgtggtc
gccaaagagttcccgtttgcaggagttcccatctcggggtgtcttggagatcagcatgct
gctatgcttgggcagctgtgccagaagggtgaagcgaaaagcacctatggaactggtgcc
ttcatccttcttaacacaggggaagagcctacccaatcctcccatggccttcttagtacc
attgcttacaagcttggtccagctgcacccactaactatgctcttgaagggtccattgca
attgcaggcgcagcagttcagtggctgagggacagccttggaatcattcagtcagcagct
gagatcgaaaagttggctgaaacagtgccagattcaggtggagtgtactttgtgccagca
tttaatgggttgtttgcaccatggtggagagatgatgcgaggggaatttgcatcggaatc
acaaggttcacaaataaggggcacattgctcgagcagtgctcgagagtatgtgttttcag
gtgaatgatgtcctcagctccatgcacaaggatgctggagaggcaggagaagtaaagagc
gcagaaggagagttcttattgcgtgttgatggtggtgctactgttaataatcttctaatg
cagatccaggctgatttattaggcagccctgttgtcagaccagctgacatagagaccaca
gccctcggagctgcatatgctgctgggttggctgcaggagtttggaccaaggagaaggtt
tttgcaggtttgcacaaggagaacacgacagtcttccgcccgaaactggatgaggcgcac
aggaaaaagagggcggattcatggtacaaggcggtttcaagatcattcgatctggctgat
ctttctctgtaa

DBGET integrated database retrieval system