KEGG   Zea mays (maize): 100193783Help
Entry
100193783         CDS       T01088                                 

Gene name
IDP701
Definition
LOC100193783
Orthology
K03259  
translation initiation factor 4E
Organism
zma  Zea mays (maize)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100193783 (IDP701)
Messenger RNA biogenesis [BR:zma03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100193783 (IDP701)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100193783 (IDP701)
Translation factors [BR:zma03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100193783 (IDP701)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
1
AA seq 229 aa AA seqDB search
MEAAAENKEAEQEQQQLPHARKDNAPAAAEEDEADSEETERRNRDLKSGLHPLRHKLVLW
YTRRTPGARSQSYEDNIKKIIDFSTVESFWVCYCHLARPSSLPSPTDLHLFKDGIRPLWE
DPANQNGGKWIIRFKKAVSGRFWEDLVLVVVGDQLEYSDDVCGVVLSVRFNEDILSVWNR
NASDHQAVMALRDSIKRHLKLPHSYLMEYKPHDASRRDNSSYRNTWLRG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcggcggagaataaggaggccgagcaggagcagcagcagctaccgcacgcg
cggaaggataacgcgcccgccgccgccgaggaagacgaagcggattcggaggagaccgag
cgccgcaaccgcgacctcaagtccggccttcacccccttaggcacaaactcgtgctctgg
tacactcgccggacgcctggagcgaggtcgcagtcgtacgaggacaacatcaagaagatc
atcgatttcagcacagtcgaatcgttctgggtttgctactgccaccttgcgcgcccttct
tccctgccgagccccactgaccttcatctcttcaaggatggcatccgtcccctctgggag
gatcctgcaaaccagaatggtggcaagtggataattagattcaaaaaggcagtttcaggt
cgattttgggaggatttggtgctagtggtagtaggcgaccaacttgagtatagcgatgat
gtctgtggtgttgtgcttagtgtccgtttcaatgaagacattctgagcgtctggaaccgg
aacgcatcagaccatcaggctgtgatggcattgagggattctataaagaggcacctcaag
ctgccacacagctatctgatggagtacaaaccccatgatgcttcgcggcgtgacaactcg
tcctacaggaacacatggctgagaggatag

DBGET integrated database retrieval system