KEGG   Zea mays (maize): 100193944Help
Entry
100193944         CDS       T01088                                 

Definition
putative pyruvate dehydrogenase kinase family protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100193944
Protein kinases [BR:zma01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100193944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 363 aa AA seqDB search
MALEPVARAVAEEVARWGAMRQTGVSLRYMMEFGVRPTERTLLLAAQFLHKELPIRIARR
ALDLDSLPFGLSTKPAILKVRDWYVESFRDIRSFPEVKNQEDELAFTQMIKMIKVRHTNV
VPAVALGVQQLKKDLGGPKAFPPGIHEIHQFLDRFYMSRIGIRMLIGQHVALHDPDPEPG
VIGLINTKMSPMTVARIASEDARAICMREYGSSPNVDIYGDPGFTFPYVTPHLHLMIFEL
VKNSLRAVQERYMDSDKLAPPVRIIVADGAEDVTIKITDEGGGIPRSGLSRIFTYLYSTA
ENPPDLDVHNEGVTMAGYGYGIPISRLYARYFGGDLQIISMEGYGTDAYLHLSRLGDSEE
PLT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgttggagccggtggcgcgggcggtggcggaggaggtggcgcgctggggcgcgatg
cgccagaccggggtcagcttgcgctacatgatggagttcggggtgcgccccacggagcgg
accctcctgctcgccgcacagttcctgcacaaggagctccccatccgcatcgcgcgacgg
gcgctcgacctcgactcgctccccttcggcctctccaccaagcccgccatcctcaaggtg
agagattggtatgtggagtcattccgtgacatccggtccttcccagaggtgaagaaccag
gaagatgaactcgccttcacccagatgatcaaaatgatcaaggtgcggcacaccaatgtg
gtgcctgcggttgcattgggtgtgcagcagctgaagaaggacttgggtggtccaaaggcg
ttcccacctggaatccatgagatccatcagttccttgatcgcttctacatgtcaaggatt
gggatccggatgctgatagggcagcacgtcgctttgcatgaccctgatccagagcctggt
gtgatagggcttataaacacaaaaatgtcacccatgacagtagctcgaattgctagtgaa
gatgcacgtgctatttgcatgcgggagtatggatcatctcctaatgtcgacatatatggt
gatccggggtttacattcccatatgttacaccacatctacatctcatgatttttgagctg
gtgaagaactcccttcgcgcagtacaggaacggtatatggattctgataagcttgcacct
ccggttcgaatcatagttgctgatggagcagaggacgtgactattaagattactgatgaa
ggtggtggaataccaaggagtggtctctcaagaatttttacgtatctctatagtacagca
gaaaaccctcctgatcttgatgtacataatgaaggagtaactatggctggatatggttat
gggattcctattagtcgtctttatgctcgatatttcggcggggacttgcagatcatctct
atggaaggatatggaactgatgcatacctccacttatcacggctgggagattcggaggaa
cccttgacttaa

DBGET integrated database retrieval system