KEGG   Zea mays (maize): 100194114Help
Entry
100194114         CDS       T01088                                 

Definition
(RefSeq) uncharacterized protein LOC100194114
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
zma  Zea mays (maize)
Pathway
zma00010  Glycolysis / Gluconeogenesis
zma00051  Fructose and mannose metabolism
zma00562  Inositol phosphate metabolism
zma00710  Carbon fixation in photosynthetic organisms
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
zma01200  Carbon metabolism
zma01230  Biosynthesis of amino acids
Module
zma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
zma_M00002  Glycolysis, core module involving three-carbon compounds
zma_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100194114
   00051 Fructose and mannose metabolism
    100194114
   00562 Inositol phosphate metabolism
    100194114
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100194114
Enzymes [BR:zma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100194114
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100194114
  Exosomal proteins of bladder cancer cells
   100194114
  Exosomal proteins of melanoma cells
   100194114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 100194114
NCBI-ProteinID: NP_001132639
UniProt: B4FHH4
Position
8
AA seq 250 aa AA seqDB search
MGRKFFVGGNWKCNGTTDQVEKIVKTLNEGNVPPSDVVEVVVSPPYVFLPVVKSQLRQEF
QVAAQNCWVKKGGAFTGEISAEMLVNLGVPWVILGHSERRALLGESNEFVGDKVAFALSQ
GLKVIACVGETLEEREAGSTMDVVAAQTKAIAEKIKDWSNVVLAYEPVWAIGTGKVATPA
QAQEVHASLRDWVKINVSPEVSESTRIIYGGSVTAANCKELAAQPDVDGFLVGGASLKPE
FIDIINAAAV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcaagttcttcgttggtggcaactggaaatgcaatggaaccacagatcaggtt
gagaagattgtcaaaaccctgaatgaaggaaatgttcccccttcagatgttgttgaggtc
gttgtcagtcctccttatgtgttcctcccggtggtcaagagccagctgcgccaagagttc
caagttgctgctcagaactgctgggtgaagaagggaggtgcattcaccggtgaaattagt
gctgagatgctcgtcaaccttggcgttccctgggtcattcttggacactctgaaaggaga
gctctgctgggagaatcaaatgagtttgttggagacaaggttgcttttgctctgtctcag
ggactaaaggtcattgcatgtgttggtgagacccttgaggagagggaggctggttcaacc
atggatgttgttgctgcacaaacaaaagcaattgctgagaagatcaaggactggagcaac
gttgttcttgcctatgaaccagtctgggctattggaactggcaaagtcgccaccccagct
caggctcaggaagtgcacgcctccctgagggattgggtaaagatcaatgtcagccctgag
gtctctgaatctacaaggatcatctatggaggttcagtaactgctgcgaactgcaaagag
ctggcagcacagcctgatgtcgatggtttccttgtgggcggtgcttctttgaagcccgag
ttcatcgacatcatcaacgccgccgccgtgtga

DBGET integrated database retrieval system