KEGG   Zea mays (maize): 100194114Help
Entry
100194114         CDS       T01088                                 

Definition
(RefSeq) uncharacterized LOC100194114
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100194114
   01230 Biosynthesis of amino acids
    100194114
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100194114
   00051 Fructose and mannose metabolism
    100194114
   00562 Inositol phosphate metabolism
    100194114
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100194114
Enzymes [BR:zma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100194114
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100194114
  Exosomal proteins of bladder cancer cells
   100194114
  Exosomal proteins of melanoma cells
   100194114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 250 aa AA seqDB search
MGRKFFVGGNWKCNGTTDQVEKIVKTLNEGNVPPSDVVEVVVSPPYVFLPVVKSQLRQEF
QVAAQNCWVKKGGAFTGEISAEMLVNLGVPWVILGHSERRALLGESNEFVGDKVAFALSQ
GLKVIACVGETLEEREAGSTMDVVAAQTKAIAEKIKDWSNVVLAYEPVWAIGTGKVATPA
QAQEVHASLRDWVKINVSPEVSESTRIIYGGSVTAANCKELAAQPDVDGFLVGGASLKPE
FIDIINAAAV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcaagttcttcgttggtggcaactggaaatgcaatggaaccacagatcaggtt
gagaagattgtcaaaaccctgaatgaaggaaatgttcccccttcagatgttgttgaggtc
gttgtcagtcctccttatgtgttcctcccggtggtcaagagccagctgcgccaagagttc
caagttgctgctcagaactgctgggtgaagaagggaggtgcattcaccggtgaaattagt
gctgagatgctcgtcaaccttggcgttccctgggtcattcttggacactctgaaaggaga
gctctgctgggagaatcaaatgagtttgttggagacaaggttgcttttgctctgtctcag
ggactaaaggtcattgcatgtgttggtgagacccttgaggagagggaggctggttcaacc
atggatgttgttgctgcacaaacaaaagcaattgctgagaagatcaaggactggagcaac
gttgttcttgcctatgaaccagtctgggctattggaactggcaaagtcgccaccccagct
caggctcaggaagtgcacgcctccctgagggattgggtaaagatcaatgtcagccctgag
gtctctgaatctacaaggatcatctatggaggttcagtaactgctgcgaactgcaaagag
ctggcagcacagcctgatgtcgatggtttccttgtgggcggtgcttctttgaagcccgag
ttcatcgacatcatcaacgccgccgccgtgtga

DBGET integrated database retrieval system