KEGG   Zea mays (maize): 100216580Help
Entry
100216580         CDS       T01088                                 

Definition
hypothetical protein
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
zma  Zea mays (maize)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 319 aa AA seqDB search
MSRPNTRNKNKRPRADESNSPSVAVFKKIHSTGDISKSDICQLYMVWKPLCHGCHGNSKD
SPNCFCGLIPIGNGVRKSGLWQKTQEIIRGLGPNPSSDLRDSSETPAGLTNLGATCYANS
ILQCLYMNTSFRSGIFSLDLDVLKKHPVLDQLVRLFAQLQSSKMAFIDSTPFIKALELDN
GVQQDSHEFLTLFLSLLEQSLSHSKVPGTREIVQHLFRGSVSHVTRCSSCGKDSAASSKS
EDFYELELNIKGFNNLEESLDDYFSEEGLVGENQYFCESCQKRVDATRCIKLRSLPPVVN
FQLKRYVFLPKVISGPFFY
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggccgaatacccgcaacaagaacaagaggcctcgcgctgatgaatccaatagc
ccatctgtggctgttttcaagaagatacattccactggtgatatctcaaaaagcgatatc
tgtcagctttacatggtgtggaaaccgctttgccacggttgccatggtaactccaaggac
tcaccaaattgtttctgcgggttgattcccattggcaatggggttcgtaaatctggcctc
tggcagaaaactcaggaaattatccgtggtcttggtcctaatccatctagtgatcttcgt
gattctagcgagacacctgctgggttgactaacctgggagcaacttgttatgcgaatagt
attctacagtgcctttacatgaacacatccttccgatctggtattttctcattggatctg
gatgttttgaagaagcatccagttttagatcagctggttcggttgtttgcacaactacag
tctagcaaaatggctttcattgattcaacgccttttattaaggcattggaattagacaat
ggtgtccagcaggatagccatgaatttctcaccttgtttctgtctctccttgagcaatca
ctaagtcactccaaggtccctggaactagagaaatagtgcaacatctgtttcgtggcagt
gtatctcatgtaacaaggtgctcatcatgtggaaaggattcagcagcatcttcaaaatct
gaagacttctatgaactcgagctgaatattaaaggtttcaataatttggaagaaagtcta
gacgactactttagtgaagaaggactagttggggagaatcaatacttttgtgaatcatgt
cagaaaagggtagacgccactcgctgcataaaacttagatcacttcctccagttgttaat
tttcagctgaagcgttatgtattcctcccgaaggtgatatctggcccatttttttattga

DBGET integrated database retrieval system