KEGG   Zea mays (maize): 100216593Help
Entry
100216593         CDS       T01088                                 

Definition
uncharacterized LOC100216593
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
zma  Zea mays (maize)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100216593
Translation factors [BR:zma03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100216593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 337 aa AA seqDB search
MGGGNQPARVSLVQIPGKEELRQKNLFSVSDCKMYWQNSGEYLAVQVDRYTKTKKSTYTG
FELFRIKERDIPIEVLELENKNDKIIAFAWEPKGHRFAIIHGDGPKPDVSFYTMRTSNNT
SRVSKLTTLKAKQANTLYWSPAGRFIVLAGLKGFNGQLEFYNVDELETMATGEHFMATDI
MWDPTGRYLATAVTSVHEMENGFQIWSFSGKHLYKVSKDHFYQFIWRPRPPSLLTAEKEE
EISRNLKKYSKKYEQEDQDAFNQLSEQDRKRRTQLQEEWDSWVAKWKQMHEEERAYRREL
RDGEASDDEEEYEAKEVEVEEVVDVRQEVLAFDLDQE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgggtggtggaaatcagcctgcgagggtgagtctagtgcaaatccctggcaaagaggag
ctgcgacagaaaaaccttttcagtgtcagtgattgtaagatgtattggcaaaacagtgga
gaatatcttgctgttcaagttgatagatacacaaaaacaaaaaagagcacctacactggg
tttgagctgtttagaattaaggagagggatatcccaattgaggtccttgaactcgagaac
aagaacgacaagatcattgcatttgcatgggaacctaaaggacatcgctttgctatcatc
catggtgatggccctaagcctgatgttagcttctacaccatgcgaacttccaataacact
agccgtgtatccaagctcacaaccctcaaggccaagcaagctaatactctgtactggtct
cctgctgggcgcttcatagttcttgctggactgaagggtttcaacgggcagctggaattc
tacaatgttgatgaactagagacaatggcaacaggagagcattttatggcaacagatatc
atgtgggatccaactgggagatatctcgcgactgcagttacctcagttcatgaaatggag
aatggctttcaaatatggtccttcagtggcaagcatctttacaaggtgtcaaaggatcat
ttctatcagtttatatggcgcccgagaccgccctcactactgacggccgagaaggaagaa
gagatctcaaggaacctgaagaagtatagcaagaagtacgaacaagaagaccaggatgca
ttcaatcagttgagcgagcaggaccgcaagaggcggacacagcttcaggaagaatgggac
tcatgggttgccaagtggaagcagatgcatgaggaggagcgtgcttacaggagggagctc
agggatggggaggccagcgacgacgaggaagagtatgaggccaaggaagttgaggtggag
gaagtcgttgatgtccgtcaagaagttcttgcattcgacctagatcaggagtga

DBGET integrated database retrieval system