KEGG   Zea mays (maize): 100216833Help
Entry
100216833         CDS       T01088                                 

Gene name
GNAT16
Definition
GNAT transcription factor
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100216833 (GNAT16)
Transfer RNA biogenesis [BR:zma03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100216833 (GNAT16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 570 aa AA seqDB search
MATAATAMVVPEQPRRRKPAPGRGGVALPAGLSEEEARVRAIAEIVSAMGELSRRGEDVD
LNALKSAACRRYGLARAPKLVEMIAAVPEADRAALLPRLRAKPVRTASGIAVVAVMSKPH
RCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKR
LGHSVDKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAICYSEHSAVKCIG
MTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDA
GFKVVAHMMPDLPNVGVERDLESFREFFESPAFRADGLKIYPTLVIRGTGLYELWKTGRY
RNYPPELLVDIVARILSMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLK
CRDVRTREAGIQDIHHKIRPDEVELVRRDYAANEGWETFLSYEDTRQDILIGLLRLRKCG
RNVTCPELVGRCSIVRELHVYGTAVPVHGRDVDKLQHQGYGTLLMEEAERIAQKEHRSEK
LAVISGVGTRHYYRKLGYELEGPYMVKCLA
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgccgccaccgccatggtggtacccgagcagccgcgccgccggaagccggcc
ccggggcgcgggggagtggccctccctgcgggtctctcggaggaggaggccagggtgcgg
gccatcgccgagattgtctcggcgatgggggagctctcgcggcgcggggaggacgtggac
ctcaacgcgctcaagtccgccgcgtgccggagatacggtctggcgcgagcgcccaagctg
gtggagatgatcgctgccgtgcccgaggccgaccgcgccgcgctgctgccgcggttgcgc
gctaagcccgtgcgcacggcgtcgggtatcgccgtcgtcgccgtcatgtcgaagccgcac
cgttgcccccacatcgctaccaccggtaacatctgtgtctactgcccgggcggtcccgac
tccgacttcgagtacagcacgcaatcctacactggatacgaacccaccagcatgcgtgcc
attcgggcaaggtataatccatatgtgcaagccaggagcaggatagatcagctcaagagg
ttagggcatagtgtggataaggtcgagttcatcttgatgggtgggactttcatgtcctta
ccagctgattatcgcgattattttatcagaaatcttcatgatgctttgtcggggcacact
tcagcaaatgttgaggaggctatttgttattccgaacatagtgctgtcaaatgtattggt
atgacgattgaaacgagacctgattattgcttggggcctcatctgcgccagatgctatct
tatggttgtactcgcctggaaattggtgtccagagtacatatgaagatgttgcccgtgac
acaaacagaggacacacggtggctgctgttgctgattgcttctgtttggcaaaagatgct
gggtttaaggtggttgcccacatgatgccagatttacctaatgttggagttgaaagagac
ttagaaagtttcagagagttttttgaaagtccagcattccgggctgatggtctgaagatt
tatccaacacttgttattcgtggaactggtctttatgagctctggaaaactggcagatat
agaaattatccacctgagctcttggtggatatcgtggcaagaattctgtctatggttcca
ccatggacacgagtgtatcgggtccagagagatattcctatgcctcttgtcacttctggt
gttgagaaaggtaaccttcgtgagctagctttggctcgaatggatgatctgggcctaaaa
tgccgagatgtcagaacccgtgaagcagggattcaggatatccatcacaagatcaggcct
gatgaagtagagcttgttagacgtgactatgctgcaaatgagggctgggagacgttcctc
tcttatgaggatacacgacaggatatcctgatcggcctgttgcgcttgcgtaaatgtggc
cgtaatgttacatgccctgaacttgtagggaggtgttcaattgttcgtgagcttcatgtc
tatggaactgcagtccctgtgcatggccgtgatgtagacaagctacagcaccaggggtat
ggaactctgttaatggaagaagcagaaaggattgctcaaaaggagcaccgttcagagaaa
ttggctgtcatttcgggggttggtactcgccactactaccgcaaactgggttatgagcta
gaaggaccttatatggtcaaatgtttggcataa

DBGET integrated database retrieval system