KEGG   Zea mays (maize): 100217163Help
Entry
100217163         CDS       T01088                                 

Gene name
pco089222
Definition
LOC100217163
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
zma  Zea mays (maize)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100217163 (pco089222)
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100217163 (pco089222)
Protein phosphatases and associated proteins [BR:zma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100217163 (pco089222)
Transcription machinery [BR:zma03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100217163 (pco089222)
Spliceosome [BR:zma03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100217163 (pco089222)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 304 aa AA seqDB search
MDRGTVEDLIRRLLDGKKHKATGKKVQLTETEIRHLCVTAKEIFLSQPNLLELVAPINVC
GDIHGQFSDLLRLFEYGGLPPTANYLFLGDYVDRGKQSIETICLLLAYKIRYPDNFFLLR
GNHECASINRIYGFYDECKRRFSVRLWKIFTDCFNCLPVAAVIDDKILCMHGGLSPDLDN
LNRIREIQRPVDVPDQGLLCDLLWSDPDRDSSGWGDNDRGVSFTFGADKVTEFLNKHDLD
LVCRAHQVVEDGYEFFADRQLVTIFSAPNYCGEFNNAGALMNVDASLLCSFQILKPYRGK
AQTE
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggacaggggaacggtggaggacctcatacggcggttgctggacgggaagaagcacaag
gcgacggggaagaaggtgcagctgaccgagaccgagatccggcacctctgcgtcaccgcc
aaggagatcttcctctcccagcccaacctcctcgagctggtggcccccatcaacgtctgc
ggtgacatccacgggcagttctcggacctgctgcggctcttcgagtacggcggcctgccg
ccgacggccaactatctcttcctcggcgactacgtggaccgcggcaagcagagcatcgag
accatctgcctgctgctggcgtacaagatccggtacccggacaacttcttcctgctccgg
ggcaaccacgagtgcgcctccatcaaccgcatctacggcttctacgacgagtgcaagcgc
cgcttcagcgtccgcctctggaagatcttcaccgactgcttcaactgcctgcccgtcgcc
gccgtcatcgatgacaagatactatgcatgcacggcgggctctccccggacctggacaac
ctcaaccggatcagggagatccagcgccccgtcgacgtccccgaccagggcctcctctgc
gacctcctgtggtccgacccggaccgcgacagctccggatggggcgacaacgaccgcggc
gtctccttcaccttcggcgccgacaaggtcaccgagttcttaaacaagcacgacctcgac
cttgtctgccgcgcccaccaggtcgtggaggacggctacgagttcttcgccgaccggcag
ctggtgaccatattctcggcgcccaactactgcggcgagttcaacaacgccggcgcgctg
atgaacgtcgacgccagcctgctctgctcgttccagatcctcaagccgtacaggggcaaa
gcacaaacggagtga

DBGET integrated database retrieval system