KEGG   Zea mays (maize): 100217298Help
Entry
100217298         CDS       T01088                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100217298
   00052 Galactose metabolism
    100217298
Enzymes [BR:zma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     100217298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 363 aa AA seqDB search
MARAPLLLALLCACAAAAGSANAAGRKMVGVYELKAGDFSVGVTNWGATITSVVLPDSKG
DFADVVLGYDTIGGYVSGKSYFGALVGRVANRIANARFVLDGKAYHLFKNDGNNTLHGGH
RGFSQVVWTVKEFVGGGDSPYITLYYHSFDGEQGFPGDLDVYVTYQLAAPYVLRVHMNAT
AVNKATPVNLAQHTYWNLGGQGSGDVLRNTVQLFASRYTPVGGGLIPTGAVAPVAGTPYD
FLAPAAVGSRIRQVSGGKAGVYGYDTNYAVDGEPGALRKVAVVRDGASGRALELWANQPG
VQFYTGNFLQDVKGKGGKVYQQYGALCLETQGFPDAVNHPNFPSQIVRPGQVYKHDMVFK
FSF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggctagagctccgctgctcctcgcgctgctgtgcgcgtgcgccgccgccgccggctcc
gccaatgcggcggggaggaagatggtcggcgtgtacgagctcaaggcgggcgatttctcc
gtcggcgtcaccaactggggcgccaccatcacctccgttgtgctgccggactccaaaggg
gattttgctgacgtcgtgcttggctacgacaccattggaggatacgtgagtggtaaaagc
tacttcggagcgcttgtcggacgagtggccaacaggatcgccaacgcgcgcttcgtgctc
gacggaaaggcttaccatcttttcaagaacgatggcaacaacacgcttcatggtggccat
agggggttcagtcaggttgtatggacggttaaagagttcgtcggtggcggtgactcgccc
tacatcacgttgtactaccacagcttcgatggagaacaaggtttcccaggcgacctggac
gtgtacgtgacgtaccagctggcggccccctacgtgctgcgggtgcacatgaacgcgacg
gccgtgaacaaggcgaccccggtgaacctggcgcagcacacgtactggaacctgggcggg
cagggcagcggcgacgtcctccgcaacacggtgcagctgttcgcgtcccggtacacgccc
gtgggcggcggcctcatcccgacgggcgcggtggcgcccgtggccggcacgccctacgac
ttcctcgcgccggccgcggtgggctcgcgcatccgccaggtctccggcggcaaggccggc
gtctacggctacgacaccaactacgccgtggacggggagcccggggcgctgcggaaggtg
gccgtcgtccgggacggcgcgtccggccgggcgctggagctgtgggccaaccagcctggg
gtgcagttctacacgggcaacttcctccaggacgtcaaggggaagggcggcaaggtgtac
cagcagtacggcgcgctgtgcctcgagacgcaggggttcccggacgccgtcaaccacccc
aatttcccctcccagatcgtcaggccggggcaggtgtacaagcacgacatggtgttcaag
ttctccttctag

DBGET integrated database retrieval system