KEGG   Zea mays (maize): 100272286Help
Entry
100272286         CDS       T01088                                 

Gene name
pco076382
Definition
(RefSeq) uncharacterized protein LOC100272286
  KO
K10739  replication factor A2
Organism
zma  Zea mays (maize)
Pathway
zma03030  DNA replication
zma03420  Nucleotide excision repair
zma03430  Mismatch repair
zma03440  Homologous recombination
Module
zma_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100272286 (pco076382)
   03420 Nucleotide excision repair
    100272286 (pco076382)
   03430 Mismatch repair
    100272286 (pco076382)
   03440 Homologous recombination
    100272286 (pco076382)
DNA replication proteins [BR:zma03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100272286 (pco076382)
DNA repair and recombination proteins [BR:zma03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100272286 (pco076382)
   MMR (mismatch exicision repair)
     100272286 (pco076382)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100272286 (pco076382)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C RMI2 tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 100272286
NCBI-ProteinID: NP_001339487
Position
5
AA seq 273 aa AA seqDB search
MMPLSQTDFSPSQFTSSQNAAADSTTPSKMRGASSTMPLTVKQVVDAQQSGTGEKGAPFI
VNGVEMANIRLVGMVNAKVERTTDVTFTLDDGTGRLDFIRWVNDASDSFETAAIQNGMYI
AVIGSLKGLQERKRATAFSIRPITDFNEVTLHFIQCVRMHIENTELKAGSPARINSSMGV
SFSNGFSESSTPTSLKSSPAPVTSGSSDTDLHTQVLNFFNEPANLESEHGVHVDEVLKRF
KLLPKKQITDAIDYNMDSGRLYSTIDEFHYKAT
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgttgagccaaaccgacttctcgccgtcgcagttcacctcctcccagaatgcc
gccgccgactccaccacgccttccaagatgcgcggcgcgtccagcaccatgccgctcacc
gtgaagcaggtcgtcgacgcgcagcagtctggcacgggcgagaagggcgctccgttcatc
gtcaatggcgtcgagatggctaacattcgacttgtggggatggtcaatgccaaggtggag
cggacgaccgatgtgaccttcacgctcgacgatggcaccggccgcctcgatttcatcaga
tgggtgaatgatgcttcagattcttttgaaactgctgctattcagaatggtatgtacatt
gcggtcattggaagcctcaagggactgcaagagaggaagcgtgctactgctttctcaatc
aggcctataaccgatttcaatgaggttacgctgcatttcattcagtgtgttcggatgcat
atagagaacactgaattaaaggctggcagtcctgcacgaatcaattcttctatgggagtg
tcattctcaaatggattcagtgaatcaagcacaccgacatctttgaaatccagtcccgca
ccggtgaccagcgggtcatccgatactgatctgcacacgcaggtcctgaatttttttaat
gaaccagcgaacctcgagagtgagcatggggtgcacgttgatgaagtactcaagcggttc
aaacttttgccgaagaagcagatcacggatgctattgattacaatatggactcggggcgt
ctttactcaacaattgatgaattccactacaaggcaacttaa

DBGET integrated database retrieval system