KEGG   Zea mays (maize): 100272286Help
Entry
100272286         CDS       T01088                                 

Gene name
pco076382
Definition
LOC100272286
Orthology
K10739  
replication factor A2
Organism
zma  Zea mays (maize)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100272286 (pco076382)
   03420 Nucleotide excision repair
    100272286 (pco076382)
   03430 Mismatch repair
    100272286 (pco076382)
   03440 Homologous recombination
    100272286 (pco076382)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 188 aa AA seqDB search
MYTLSLKHSSSTFSVGKSPCFCADVHWLSRNGMYIAVIGSLKGLQERKRATAFSIRPITD
FNEVTLHFIQCVRMHIENTELKAGSPARINSSMGVSFSNGFSESSTPTSLKSSPAPVTSG
SSDTDLHTQVLNFFNEPANLESEHGVHVDEVLKRFKLLPKKQITDAIDYNMDSGRLYSTI
DEFHYKAT
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtatacattgtccctaaagcattccagtagtaccttttctgtaggaaagtcaccatgc
ttttgtgcggatgtacattggttatcaaggaatggtatgtacattgcggtcattggaagc
ctcaagggactgcaagagaggaagcgtgctactgctttctcaatcaggcctataaccgat
ttcaatgaggttacgctgcatttcattcagtgtgttcggatgcatatagagaacactgaa
ttaaaggctggcagtcctgcacgaatcaattcttctatgggagtgtcattctcaaatgga
ttcagtgaatcaagcacaccgacatctttgaaatccagtcccgcaccggtgaccagcggg
tcatccgatactgatctgcacacgcaggtcctgaatttttttaatgaaccagcgaacctc
gagagtgagcatggggtgcacgttgatgaagtactcaagcggttcaaacttttgccgaag
aagcagatcacggatgctattgattacaatatggactcggggcgtctttactcaacaatt
gatgaattccactacaaggcaacttaa

DBGET integrated database retrieval system