KEGG   Zea mays (maize): 100272355Help
Entry
100272355         CDS       T01088                                 

Gene name
gpm529
Definition
LOC100272355
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100272355 (gpm529)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
4
AA seq 232 aa AA seqDB search
MEEHGLWSSGASDKNKSMVEQLQRYGVIRSTKVAEVMEAIDRGLFVPPGGSPYHDSPMPI
GYNATISAPHMHAACLELLEKNLQPGMRALDVGSGTGYLTACFALMVGPEGRAVGVEHIP
ELVATSTENIKKSAAAPHLNDGSLSIHVSDGREGWPELAPYEAIHVGAAAPQIPEALIEQ
LKPGGRMVIPVGTVFQELKVVDKKLDGTVSIRDETSVRYVPLTSKDAQLHAS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcatgggctgtggtccagcggggccagcgacaagaacaagtccatggttgag
cagctgcagaggtacggggtcatcaggtcgaccaaagtcgcggaggtgatggaggccatc
gacagggggttgttcgtgccacctgggggctcgccataccacgatagccccatgccgatt
gggtacaatgccaccatatcagcaccacacatgcatgcggcttgcctggagctactggag
aagaatcttcagcctggaatgcgagctctcgatgttgggtcaggcactggatacctaact
gcttgctttgcactgatggttggaccagaagggcgagcagttggtgtcgaacatatccca
gagttggttgctacttctactgaaaacatcaagaaaagtgcagcagccccacatctaaat
gatggatccctcagtatacacgtttctgatggcagggaaggttggccagaactggcaccc
tatgaagccatccatgttggagctgcagcaccgcagatccccgaggcgctgatcgagcag
ctgaagcccggcggcagaatggtgatccctgtcgggacagtcttccaggagctgaaggtt
gtggacaagaagttggatggcactgtcagcataagagacgaaacgtctgtgcgctatgtg
ccgctcactagcaaggacgcccagttgcacgcaagctga

DBGET integrated database retrieval system