KEGG   Zea mays (maize): 100272578Help
Entry
100272578         CDS       T01088                                 

Gene name
cl33662_1
Definition
LOC100272578
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:zma01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:zma00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:zma00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:zma00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 384 aa AA seqDB search
MAAADASSLPPSAITCRAAVAWGPGQPLVMEEVEVAPPGPMEIRVKVVSTSVCRSDVTAW
QSKAQLDLFPRVFGHEASGVVESVGEGVTEFQVGDHVLTVFIGECKSCKHCVSGKSNMCQ
KLGLERKGVMHSDQKTRFSVKGKPVYHYCAVSSFSEYTVVHSGCAVKVGLTVPMDRVCLL
SCGVSSGLGAVWNVANVSKGSSVAIFGLGTVGLSVAQGAKLRGASKIIGVDTNPEKQEKG
KSFGVTDFINPDELSEPVQQVIKRITDGGVDYSFECVGDSGVVSTALQSCSDGWGVTVTL
GLPKGKLEVSTHYAFLLSGRTLKGSMFGGWKPKSDLPSLVDKYAAKEIQVDGLVTHDIPF
NEINKALELMLENKCLRCVIHMPR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgccgatgcatcttcgttgcctccgtccgccatcacctgccgagcggcggtg
gcgtggggaccgggccagccactggtgatggaggaggtggaggtcgccccgccggggccc
atggagatccgtgtcaaggtcgtctccacctccgtctgccgcagcgacgtcactgcctgg
caatccaaggcgcaacttgatctgttccccagagtcttcggccacgaggcatccggagta
gtagagagtgtcggtgaaggtgtgaccgagttccaagtcggtgaccacgttctcactgtc
ttcattggggaatgcaagagctgcaagcactgcgtctcagggaagagcaacatgtgccag
aagctcggtctggagaggaagggtgtcatgcacagcgatcagaagacacgcttctctgtc
aaggggaaacctgtgtaccattactgtgcagtgtcaagcttcagcgagtacacggttgtc
cattccggatgtgcggtgaaggttggcctgaccgtgccaatggacagggtgtgcctgctg
agctgcggtgtgtcttcaggactcggtgcagtctggaatgtagctaatgtatcaaagggc
tcaagtgtagctatatttggtcttgggaccgtaggactttctgtcgctcaaggtgctaag
cttcgaggggcgtccaagattataggagttgatactaatcctgagaagcaagaaaagggg
aaatcatttggtgtcacggactttattaacccagatgaattgagtgaacctgttcaacag
gtaatcaaaaggattactgatggaggggtggattactcatttgaatgtgtgggtgattct
ggagtagtctccactgcacttcaatcatgttctgatggttggggagtaactgtaactctt
ggcttaccaaaaggaaaactagaagtgtctactcattatgcatttcttctatccggaaga
acactgaagggatctatgtttggaggatggaaacctaaatctgatctaccttcattggtg
gataaatatgcagcaaaggaaatccaagttgatggcctagtcacgcatgatataccattc
aatgaaatcaacaaagcgcttgagttgatgctagaaaacaagtgcttgagatgtgtgatt
cacatgccacggtaa

DBGET integrated database retrieval system