KEGG   Zea mays (maize): 100272618Help
Entry
100272618         CDS       T01088                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:zma00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:zma00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 336 aa AA seqDB search
MAAEPKILELSNGKITARISNWGATITSLLVPDAQGSVADVVLGFDGLDPYVKGMSPYFG
CIVGRVANRIKDGKFTLNGLEYSLPVNNGPNSLHGGLKGFDKVVWDVVEHKDGECPSITF
QYHSKDGEEGYPGDVTIRATYSLPEATTLRLDMEATPENKATPISLAQHTYWNLAGHACG
DILNHSLQIWGKHITPVDENTIPTGEIMPVDGTPFDFTTERRIGERIDGVPGGYDHNYVL
DCGDEKDGLKRAARLKDPSSLRTLDLWTDAPGMQLYTANYVDGIGGKAGAVYAKHAGVCL
ETQGFPNAINQPEFPSVVVRPGEKYKHTMLFEFSGC
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgagcccaagatcctagagctctccaacggcaagatcaccgcgaggatctcc
aactggggcgccaccatcacctccctcctcgtccccgacgcccaggggagtgtcgctgat
gtggtgctcggattcgatggcttggatccgtacgtgaaaggcatgtcaccttattttggc
tgcatagttggccgtgtcgcgaataggatcaaggatgggaagtttacactaaacggactt
gagtattcattacctgtcaacaatggacctaacagccttcatggtgggttgaagggattt
gataaggtcgtgtgggatgtcgtggagcacaaagatggcgaatgcccttcaataactttt
cagtatcacagcaaggacggggaagaaggctatccaggcgatgtaaccattcgagcaaca
tactctcttcctgaagctactactctaaggcttgacatggaagctacaccagagaacaaa
gcaactcctataagcctggcgcagcacacctactggaacctcgcaggtcacgcctgcggc
gacatcttaaaccactcgctgcagatctggggcaagcacatcactccggtcgacgagaac
acaattcccaccggcgagataatgcccgtcgatggcaccccttttgacttcacgacggag
cgcaggattggcgagcgcatcgacggtgttcctggagggtatgatcataactacgtgctg
gactgtggcgacgagaaggacggcctgaagcgtgcggccaggctgaaagatccgtcgagc
ttgcggaccctggacctgtggactgacgcacccggcatgcagctgtacactgccaactac
gtggatggcatcggtggcaaggcgggcgctgtctacgcgaagcatgctggagtgtgcttg
gaaacccaggggttcccgaatgccatcaaccagcctgagtttccctctgtggttgttcgg
cccggtgagaagtataagcatactatgctgtttgagttctcgggatgttga

DBGET integrated database retrieval system