KEGG   Zea mays (maize): 100272721Help
Entry
100272721         CDS       T01088                                 

Gene name
pco068984(32)
Definition
LOC100272721
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
zma  Zea mays (maize)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100272721 (pco068984(32))
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100272721 (pco068984(32))
Enzymes [BR:zma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100272721 (pco068984(32))
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 340 aa AA seqDB search
MGGAAAGTKWIHHIQRLSAAKVSAEAVERGQSRVIDASLTLIRERAKLKAELLRALGGVK
ASASLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSSTEEGKELNDPRVLTDVGDVPI
HEIRDCGVEDDRLMHVISESVKTVMEEEPLRPLVLGGDHSISYPVVRAVSEKLGGPVDIL
HLDAHPDIYDCFEGNTYSHASSFARIMEGGYARRLLQVGLRSITKEWREQGKRFGVEQYE
MRTFSKDREKLENLKLGEGVKGVYVSVDVDCLDPAFAPGVSHIEPGGLSFRNVLNILQNL
QGDVVAADVVEFNPQRDTVDGMTAMVAAKLVRELTAKISK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggtggcgcggcggcgggtaccaagtggatccaccacatccagcgcctcagcgcggcc
aaggtgtcggcggaggcggtggagcggggccagagccgcgtcatcgacgcctccctcacc
ctaattcgcgagcgcgcaaagctcaaggcagagttgctgcgtgctctgggtggcgtgaaa
gcttcagcgtcgctcttaggggtccctcttggtcacaactcatcctttttacaaggccct
gcatttgctcctccacgcatacgggaggccatttggtgtggaagcacaaactctagcaca
gaggaaggcaaagaattgaatgatcctcgggtgctaactgatgttggagatgtccccatt
cacgagatccgtgactgtggtgtcgaagatgacagattaatgcatgtaattagtgagtct
gtcaaaacagtgatggaggaggagcctcttcgaccgttggtgttaggaggcgatcattca
atatcttatccagtggttagagctgtgtctgaaaagcttggaggacctgttgacatactt
catcttgatgcacatccagatatctatgattgttttgaagggaacacttattcgcatgcc
tcgtcatttgccagaataatggaaggtggttatgccaggagactgctacaggttggattg
agatcaatcaccaaagaatggcgtgaacaagggaagagatttggtgtggaacagtatgag
atgcgaaccttctcaaaggaccgagagaagcttgagaatctgaaacttggggaaggcgta
aagggtgtgtatgtctcagttgatgtggactgccttgacccagcgtttgctcctggggtc
tctcacatcgaacctggaggcctctccttccgcaatgtcctcaacatcctccagaatttg
cagggtgacgttgtcgccgctgatgtggtggagttcaacccacagcgtgacacggtagat
gggatgacagccatggtcgccgcgaagctggttcgggagctcactgctaagatctccaag
tga

DBGET integrated database retrieval system