KEGG   Zea mays (maize): 100272981Help
Entry
100272981         CDS       T01088                                 

Definition
uncharacterized LOC100272981
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
zma  Zea mays (maize)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:zma00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100272981
Enzymes [BR:zma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100272981
Protein phosphatases and associated proteins [BR:zma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100272981
Transcription machinery [BR:zma03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100272981
Spliceosome [BR:zma03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100272981
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 323 aa AA seqDB search
MSAAPAAGGQGGGGIDAALLDDIIRRLLEVRTARPGKQVQLSESEIRQLCTVSRAIFLSQ
PNLLELEAPIKICGDIHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLA
YKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNVRLWKVFTECFNTLPVAALIDDKI
LCMHGGLSPDLAHLDEIKNLQRPTDVPDQGLLCDLLWSDPGKDVQGWGMNDRGVSYTFGA
DKVSEFLQRHDLDLICRAHQVVEDGYEFFADRQLVTIFSAPNYCGEFDNAGAMMSVDETL
MCSFQILKPAERKQIYGAKQNVR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcggcgccagcggcgggagggcagggtggcgggggcattgacgccgcgctcctc
gacgacatcatccgccgcctgctcgaggtgcggaccgcgcgcccagggaagcaggtgcag
ctctctgagtcggagatccgccagctgtgcaccgtctcccgcgccatcttcctcagccag
cccaacctcctcgagctcgaggcgcccatcaagatctgcggtgacatccatggtcaatac
agtgatcttctaaggctttttgaatatggaggttttcctcctgaagccaattatctattc
ttaggtgattatgttgatcgaggcaaacaaagtttggagactatatgccttcttcttgct
tacaaaatcaagtaccctgagaacttttttcttctgaggggcaatcatgaatgtgcctca
ataaacagaatatatggattttatgatgaatgcaagcgtcgatttaatgtgcggctatgg
aaggtcttcacagaatgttttaacactctacctgtggctgctcttatcgatgataaaata
ttatgtatgcacggtggactttctcccgatctagcacacttggatgagataaagaacttg
caacgtccaaccgatgtaccagatcaaggtctactgtgtgacttactttggtcagatcca
ggaaaagatgttcaagggtggggcatgaatgatagaggggtctcatatacctttggtgct
gacaaggtttcagaattcctgcaaaggcatgatcttgatcttatttgtcgtgctcatcag
gttgtcgaggatgggtatgaattctttgctgacagacagcttgtcaccatattctcggct
cccaattattgtggtgaatttgataatgctggcgcaatgatgagcgttgacgaaactttg
atgtgttccttccaaattctgaaacctgctgagagaaaacaaatttatggggccaaacaa
aatgtgagatag

DBGET integrated database retrieval system