KEGG   Zea mays (maize): 100272982Help
Entry
100272982         CDS       T01088                                 

Definition
anthocyaninless4
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
zma  Zea mays (maize)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    100272982
Enzymes [BR:zma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     100272982
    1.1.1.234  flavanone 4-reductase
     100272982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 361 aa AA seqDB search
MRDVVAKREAMKGGASSKGPVVVTGASGFVGSWLVMKLLQAGYTVRATVRDPENVGKTKP
LLDLPGATERLSIWKADLADEDSFDEAIRGCTGVFHVATPTDFESKDPENEVIKPTVEGM
IRILRACKEAGTVRRIVFTSSAGTVCVEERQRPVYDHDNWSDVDFCRRVKMTGWMYFVSK
SLAEKAAVAYAAEHGLDLVSVIPTLVVGPFLSAAMPPSLVTALALVTGNEAHYSILKQVQ
FVHLDDLCDAEIFLFEHPAAAGRYVCSSHDATIHGLAAMLRDRYPEYDIPQKLRGIEDEL
QLVHFSSKKLLDHGFTFRYTVEDMFDAGIRTCREKGLIPLATAGGVGSASLRTPGETARR
M
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagggatgtggtggcaaagcgggaggcgatgaagggaggcgcgagctcgaaagggccg
gtggtggtcacgggggcgtcgggcttcgtcggctcctggctcgtcatgaagcttctccag
gccggctacaccgtccgggcgaccgtgcgcgaccccgagaacgttgggaagacgaagcca
ttgctggaccttccaggagcaacggagcgcctgtccatatggaaagccgacctggcagac
gaagacagcttcgacgaagccatcaggggctgcaccggcgtcttccacgtcgccacaccc
accgacttcgagtccaaagaccctgagaatgaggtgatcaagccgacggtggaagggatg
atccgcatcttgcgagcctgcaaggaggccggcaccgtgcgccgcatcgtcttcacttcc
tccgctgggacggtctgcgtcgaggagcggcagcggcccgtctacgaccacgacaactgg
agcgacgtcgacttctgccgccgcgtcaagatgaccggatggatgtacttcgtgtctaaa
tccctggcggagaaggcggccgtggcgtacgcggcggagcacggcctggacctcgtcagc
gtcatcccgacgctcgtggtcggcccgttcctcagcgcggccatgccgcccagcctcgtc
accgcgctggcgctcgtcacggggaacgaggcccactactcgatcctgaagcaggtgcag
ttcgtccacctcgacgacctctgcgacgccgagatcttcctcttcgagcacccggccgcc
gccggacgctacgtctgctcctcgcacgacgccaccatccacggcctcgccgccatgctc
agggataggtaccccgagtatgacatcccgcagaagctccgcgggatcgaggacgaactg
cagctcgtgcacttctcgtccaagaagctcctagaccatggcttcactttcaggtacacg
gtggaggacatgttcgacgccggcatccggacgtgccgggagaagggcctcatcccgctc
gccacggccggaggggtcggctctgcctcactgcgcacacccggcgagaccgcgagacgg
atgtga

DBGET integrated database retrieval system