KEGG   Zea mays (maize): 100273030Help
Entry
100273030         CDS       T01088                                 

Gene name
GRMZM2G071959, histone2b1
Definition
(RefSeq) histone H2B.1
  KO
K11252  
histone H2B
Organism
zma  Zea mays (maize)
Brite
Chromosome [BR:zma03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100273030 (GRMZM2G071959)
Exosome [BR:zma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100273030 (GRMZM2G071959)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 151 aa AA seqDB search
MAPKAEKKPAAKKPAEEEPATEKVEKAPAGKKPKAEKRLPAGKSKEGGEGKKGKKKAKKS
VETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAAESAKLARYNKKPTITSRE
IQTSVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaaggcggagaagaagccggcggccaagaagcccgcggaggaggagcccgcg
acagagaaggtggagaaggctccggcggggaagaagcccaaggccgagaagcgcctcccg
gcgggcaagtccaaggagggcggcgagggcaagaaggggaaaaagaaggcgaagaagtcc
gtggagacctacaagatctacatcttcaaggtgctgaagcaggtgcaccccgacatcggc
atctcgtccaaggccatgtccatcatgaactccttcatcaacgacatcttcgagaagctc
gcggccgagtccgccaagctggcgcgctacaacaagaagcccaccatcacctcccgcgag
atccagacctcggtgcgcctcgtcctccccggcgagctcgccaagcacgccgtctccgag
ggcactaaggccgttacgaagttcacctcgtcttag

DBGET integrated database retrieval system