KEGG   Zea mays (maize): 100273066Help
Entry
100273066         CDS       T01088                                 

Definition
uncharacterized LOC100273066
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
zma  Zea mays (maize)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100273066
Enzymes [BR:zma01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     100273066
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     100273066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 535 aa AA seqDB search
MRQPLLPSRFLIQSLRSNGHNASPGSVLAFAPVLRCLLTSTRPHQRYYAHHACLRPLVRC
NMPDIKRNACGCARTSGGGCGSSGPQKKTAYIALGSNMGDRVAEIERACNEMDRRGIKVK
RTSSLWETEPMYVTDQDRFINGACEVETELDPIALLDQLQAIENDMGRKKVIDKGPRNID
LDILLYGDEKVDHERLKVPHIGILEREFVLRPLVELIPAKSLDPTKPWKLIQDNLNELPL
GEPLSSMTPLSSTAGSLTPLAAKRKTHVMGILNLTPDSFSDGGFHDRDNLAQTIMNMVKN
GTSIIDVGGQSTAPGRPEVSAEEEASRVVPAVQLIRSIPEARDVAISIDTYRASVAEEAI
ASGADIINDVSAGLLDPDMLSTVGRLEKTICLMHMRGTPQTMTKLTSYPDGLIPTIASEL
LERVAAAEAAGIRRWRMILDPGIGFAKTGEQNLEVLRRLEELRYWPGLQGLPWLVGSSRK
TFVGKITGVTEPKQRTWGTAATVAAAVQGGADIVRVHDTQEMGMVAKMADAIWRV
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacctcttctcccatcgcgatttcttatccagagcctcagaagcaacggccac
aatgcttctcccggctctgtcctggctttcgccccggtattgcgatgtttgttgacgtca
acaaggcctcaccagcgatattatgcccaccatgcgtgcctccgtcctcttgtaaggtgc
aacatgcctgatattaagcgcaatgcctgtggatgtgctcgcacaagtggaggtggctgt
gggagcagcggaccgcaaaagaagacggcatatatcgctcttgggagcaatatgggagac
agagttgctgagattgagcgggcatgcaacgagatggaccgccgaggaatcaaggtcaag
aggaccagtagcctctgggagacagagcccatgtatgttaccgaccaggatcgctttatc
aacggcgcttgtgaggtcgagacagaacttgaccctatagcccttctagaccaactgcaa
gccattgagaatgacatggggcgaaagaaggtcatcgacaagggtccgcgtaacattgat
ttggacatacttttgtatggcgacgaaaaggttgaccacgagcggctcaaggttccccat
atcggcatattggagcgagagtttgttctcagacccctggtcgaactcattccggcaaaa
tcattggatcctacgaaaccgtggaagctcatacaggataatctaaatgagctgcccctt
ggcgagccattgtcttccatgacaccgctttcttcgacggcaggttctttgacgcctctt
gctgcaaagcggaagacccatgtcatgggcattctcaacttgacgccggattcgttttca
gatggtggctttcacgatcgagataacctcgctcagaccattatgaatatggtcaagaac
ggaacttcgattatcgatgttggcggccagtcaactgcccctggccgaccagaagtatca
gccgaggaggaagcatcccgcgttgtgcctgctgttcagctgattcgatcgattcctgaa
gctcgtgatgtggctatcagcattgacacgtatcgtgcatccgttgccgaggaagccatt
gctagcggagcagatatcatcaacgatgtttcggctggtctgctggacccagatatgctt
tctaccgtcggccgtcttgagaaaacgatatgtctgatgcatatgcgcgggacaccgcag
accatgacaaagttgacctcgtatccagatgggcttattcccacaatagcatcagagctt
ctcgagcgcgtagcagcggccgaggcagcgggtatccggcggtggcgcatgattctggac
ccgggtatcggcttcgccaagacgggagagcagaacctcgaggttcttcgacggctggag
gagctgcgatactggccggggcttcagggcctgccgtggctcgttggatcgagccggaag
acttttgtcggcaagatcacgggagtcacggagccgaagcaacggacgtggggcacggcg
gcgacggtggcagcggcggttcagggcggtgcggacatagtgagggtacacgacacgcag
gagatgggcatggtggccaagatggctgatgctatctggagggtatga

DBGET integrated database retrieval system