KEGG   Zea mays (maize): 100273102Help
Entry
100273102         CDS       T01088                                 

Gene name
TIDP2935
Definition
LOC100273102
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
zma  Zea mays (maize)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:zma03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 384 aa AA seqDB search
MPELPEVEAARRALQAHCVGRRIARCAVADDAKVVVAAAGRAAFERAMVGRTIVAARRRG
KNLWLQLDAPPFPSFQFGMAGAIYIKGIPVTNYKRSVVNSEEEWPSKHSKFFAELDDGLE
FSFTDKRRFARVRLFEDPETLPPISELGPDALFEPMSVDSFLDSLGRKKIGIKALLLDQS
FISGIGNWIADEVLYQSRIHPLQIASNLPRESCEALHQSIEEVVKYAVEVDADMDRFPKE
WLFHHRWGKKPGKVDGKKIEFITAGGRTTAYVPQLQKLVGTQSSKTISVAENGDAKDSGT
EGEDADADVLKPRKRAATSRGQRNKDTAGSRKARGNGADAEAAEPATGVVGSNSEQAFGQ
ANSDAVDKSDRATRRSSRKVKARK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctgccggaggtggaggcggcgcgtcgggcgctgcaggcgcactgcgtgggg
aggcgcatcgcgcgctgcgccgtggcggacgacgccaaggtggtcgttgccgccgccggc
cgcgcggccttcgagcgggccatggtcggccggaccatcgtcgccgcgcgccggaggggc
aagaacctctggctccagctcgacgcgccgcccttcccgtccttccagttcgggatggca
ggcgcgatatatatcaaaggcattcctgtgacgaattataagagatccgttgttaattcc
gaagaggagtggccctccaaacactctaaattctttgctgagcttgatgatggtttggag
ttctctttcactgataaacggcgctttgcaagagttcgtttgtttgaagatcctgaaacc
ttacccccaatttctgagttaggcccagatgctctgtttgaaccaatgtccgtcgatagt
ttcttggactccctgggtagaaagaagatagggataaaagctcttctacttgatcagagc
ttcatatcaggcattggcaattggattgcagacgaggtgctttaccagtcaaggatccat
ccattacagattgcttcgaatctacctagggagagttgtgaagcactgcaccagagtatc
gaagaggttgtcaaatatgctgtcgaagttgatgctgacatggaccgctttccgaaggaa
tggttatttcatcaccgttggggcaagaagcctggcaaagtcgatggaaagaaaatcgag
ttcataacagctggtggcaggaccactgcctacgtgccgcaactgcaaaaactggttgga
acccagtccagcaaaacgatatccgtggccgagaacggtgatgccaaggattcagggacc
gagggagaagatgcagatgcagatgttttgaagccaagaaagcgagccgcgacctccagg
ggacagcgaaacaaagataccgccggctcgagaaaagcaagaggaaatggcgccgatgct
gaggcggctgaaccagcaacaggtgtcgtcggaagcaacagtgagcaagcttttggccaa
gccaacagtgacgctgtcgataaatcagatcgggctacaagacgatcgtcgaggaaagtg
aaagcccgcaagtaa

DBGET integrated database retrieval system